Recombinant Salmonella choleraesuis Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Genetic Basis

Phosphoglycerol transferase I, encoded by the mdoB gene, catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to MDOs or synthetic β-glucoside substrates like arbutin . This reaction produces sn-1,2-diglyceride, which is toxic to bacterial cells lacking diglyceride kinase (dgk) . Key characteristics include:

  • Active site localization: The enzyme operates on the outer face of the inner cytoplasmic membrane, enabling interactions with periplasmic substrates .

  • Substrate specificity: Prefers lipid-linked intermediates of MDOs over soluble forms, with arbutin serving as a model substrate in vitro .

  • Genetic mutants: mdoB knockout strains lack phosphoglycerol residues in MDOs, exhibit arbutin resistance, and show growth inhibition in dgk backgrounds .

Role in Salmonella Attenuation and Vaccine Design

Recombinant S. Choleraesuis strains with mdoB deletions are critical for developing live-attenuated vaccines. These strains exhibit:

  • Reduced virulence: By disrupting MDO modification, mdoB mutants accumulate less toxic diglycerides, enhancing safety .

  • Immunogenicity: Engineered strains (e.g., rSC0016) trigger robust IgG and mucosal IgA responses against heterologous antigens (e.g., Pasteurella multocida PlpE) .

Table 1: Immune Response in Mice Immunized with mdoB-Deficient S. Choleraesuis

StrainAntigenIgG Titer (log10)Mucosal IgA (log10)Protection Rate (%)
rSC0016 (pS-FedF)FedF4.23.880
rSC0016 (pS-rStx2eA)rStx2eA3.93.575
Wild-type C3545None<1.0<1.00
Data from challenge studies with 10,000× LD₅₀ doses .

Key Research Findings

  • MDO composition: mdoB mutants produce MDOs lacking phosphoglycerol (≤0.06 mol P-Gro/mol MDO vs. 2.0 mol in wild-type) .

  • Enzyme activity: Phosphoglycerol transferase I activity in mdoB knockouts is undetectable (<0.05 nmol/h per mg protein) .

  • Vaccine efficacy: Strains like SC3 (C500 rpoS⁺Δfur9 ΔpagL7 ΔpagP81) show 80% protection against wild-type S. Choleraesuis in murine models .

Applications and Future Directions

  • Universal vaccine platforms: Attenuated mdoB strains serve as vectors for delivering heterologous antigens (e.g., Shiga toxin subunits) .

  • Safety enhancements: Combining mdoB mutations with lipid A modifications (e.g., pagL, lpxE) reduces endotoxicity while preserving immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; SCH_4393; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIALALVAVFGALGWVLRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQMRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDNLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDGKPNQS FSAVSCSQENIAEFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRNSLSGQSLSEVFLNVKEKVLAMKPD IIRLWNFPKEIKDFTVDRDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWIDRCYKMAQLWAPALALSTDWCVSQGQLGGQQTVQHVDKAQWQGKTAFKD TMIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNAERPIPVRVGNEEQTLVLGHDVSTITLHFNNP TDANTLVIAPPAPVSTNEGNILGHSPRKLGIGMVEIKVVNVEG
Uniprot No.

Target Background

Function
Phosphoglycerol transferase I (mdoB) from Salmonella choleraesuis transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links

KEGG: sec:SCH_4393

Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (mdoB) in Salmonella choleraesuis and what is its primary function?

Phosphoglycerol transferase I, encoded by the mdoB gene, is an inner membrane enzyme that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) or to model substrates like arbutin (p-hydroxyphenyl-β-D-glucoside). The reaction produces phosphoglycerol diester derivatives of MDOs and sn-1,2-diglyceride .

This enzyme has its active site oriented toward the periplasmic space on the outer aspect of the inner cytoplasmic membrane, allowing it to access substrates in the periplasmic compartment. Functionally, mdoB contributes to membrane-derived oligosaccharide biosynthesis, which affects membrane integrity and bacterial adaptation to various environmental conditions .

How does the structural conformation of Phosphoglycerol transferase I relate to its function?

Computational structure models of Phosphoglycerol transferase I from Salmonella enterica subspecies reveal a protein with high confidence structure prediction (pLDDT global scores of 90.89 and 90.21 for different subspecies) . The protein consists of 763 amino acids with specific domains associated with substrate binding and catalytic activity.

The enzyme's structure facilitates its localization in the bacterial inner membrane, with specific regions positioned to access both the phosphatidylglycerol donor in the membrane and the oligosaccharide acceptors in the periplasm. This structural arrangement enables efficient catalysis of phosphoglycerol transfer reactions that contribute to membrane biogenesis and modification .

What are the established methods for expressing and purifying recombinant Phosphoglycerol transferase I from Salmonella choleraesuis?

Recombinant expression of Phosphoglycerol transferase I can be achieved through several expression systems:

Expression systems:

  • E. coli-based expression using T7 or similar strong promoter systems

  • Yeast expression systems

  • Baculovirus expression systems

  • Mammalian cell expression for complex structural studies

Purification protocol:

  • Bacterial cell lysis under conditions that preserve membrane protein integrity (typically using detergents)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of the membrane protein using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity chromatography using histidine or other affinity tags

  • Ion-exchange chromatography for further purification

  • Size exclusion chromatography to obtain homogeneous protein preparation

For functional studies, it's critical to maintain the protein in a detergent or lipid environment that mimics its native membrane context to preserve enzymatic activity .

How can researchers effectively measure the enzymatic activity of Phosphoglycerol transferase I in vitro?

The enzymatic activity of recombinant Phosphoglycerol transferase I can be measured using several complementary approaches:

Standard activity assay:

  • Incubate purified enzyme with phosphatidylglycerol (donor) and membrane-derived oligosaccharides or arbutin (acceptor)

  • Measure the formation of sn-1,2-diglyceride as a product using thin-layer chromatography (TLC) or liquid chromatography-mass spectrometry (LC-MS)

  • Alternatively, track the formation of phosphoglycerol-modified oligosaccharides

Arbutin-based assay:
Researchers can utilize arbutin as a model substrate, which simplifies activity measurement. The transfer of phosphoglycerol to arbutin can be monitored by:

  • Extraction of phosphoglycerol-arbutin from the reaction mixture

  • Separation by TLC or HPLC

  • Quantification through densitometry or UV absorption

Genetic complementation approach:
Activity can also be assessed through genetic complementation of mdoB mutants:

  • Transform mdoB-deficient strains with the recombinant mdoB gene

  • Assess restoration of arbutin sensitivity in dgk (diacylglycerol kinase) mutant background

  • Analyze membrane-derived oligosaccharide composition to confirm phosphoglycerol incorporation

How can modifications of the mdoB gene contribute to the development of attenuated Salmonella choleraesuis vaccine strains?

Modification of mdoB can contribute to vaccine development through several mechanisms:

Attenuation strategies:

  • Complete deletion of mdoB affects membrane-derived oligosaccharide composition, potentially reducing bacterial fitness in vivo while maintaining immunogenicity

  • Point mutations that reduce but don't eliminate enzymatic activity may create balanced-attenuation strains

  • Combination with other attenuating mutations (like ΔphoP, ΔrpoS, Δcrp, Δfur, or ΔaroA) can produce strains with optimal safety and immunogenicity profiles

Experimental evidence:
Studies on attenuated Salmonella choleraesuis strains have demonstrated that creating the right balance between attenuation and immunogenicity is critical. For example, the C500 vaccine strain with truncated rpoS showed good immunogenicity but severe side effects. Researchers then restored rpoS while deleting other virulence genes to achieve better safety profiles . Similar strategies could be applied to mdoB modification.

The regulated delayed attenuation system, which has been successfully implemented in Salmonella Choleraesuis vaccine vectors like rSC0016, could potentially incorporate mdoB regulation to enhance vaccine efficacy and safety .

What is the role of Phosphoglycerol transferase I in bacterial membrane integrity and how does this impact vaccine strain design?

Phosphoglycerol transferase I significantly influences membrane properties through:

Membrane composition effects:

  • The enzyme transfers phosphoglycerol to membrane-derived oligosaccharides, affecting periplasmic osmolarity

  • Modifications in oligosaccharide composition impact membrane fluidity and permeability

  • These changes can alter bacterial survival in diverse host environments

Vaccine design implications:

  • Mutations in mdoB can be leveraged to create strains with specifically altered membrane properties that maintain sufficient viability for antigen delivery while reducing pathogenicity

  • The altered membrane may enhance antigen presentation to the host immune system

  • Changes in membrane composition can affect the bacterium's ability to survive in various host compartments, potentially directing immune responses toward specific pathways

Table 1: Impact of membrane modifications on vaccine strain properties

Membrane ModificationEffect on Bacterial PhysiologyImmune Response ImpactSafety Profile
Reduced phosphoglycerol contentAltered periplasmic osmolarityModified antigen presentationPotentially attenuated
Changed MDO branching patternAffected membrane fluidityAltered inflammatory responseStrain-dependent
Combined lipid A and MDO changesComprehensive membrane restructuringEnhanced immunogenicityImproved safety

Research has shown that attenuated S. Choleraesuis vaccine vectors with optimized membrane properties can efficiently deliver heterologous antigens and induce robust immune responses, including mucosal, humoral, and cellular immunity .

How can Salmonella choleraesuis mdoB mutants be utilized as vectors for delivering heterologous antigens?

Salmonella choleraesuis strains with modifications in mdoB and other genes can serve as effective vectors for heterologous antigen delivery through several mechanisms:

Vector development strategies:

  • Balanced-lethal systems: Incorporating the asd gene (aspartate semialdehyde dehydrogenase) with complementation in trans ensures plasmid stability and consistent synthesis of heterologous antigens

  • Regulated delayed attenuation: Systems that maintain virulence factors during initial colonization but attenuate later enhance immune stimulation while maintaining safety

  • Membrane modifications: Alterations in mdoB function can potentially modify antigen presentation and processing

Documented applications:
Studies have demonstrated that attenuated S. Choleraesuis vectors can effectively deliver antigens from various pathogens. For example:

  • The rSC0016 vector (containing regulated delayed attenuation system) successfully expressed and delivered Pasteurella multocida PlpE antigen, inducing specific immune responses and providing 80% protection against lethal challenge

  • Similar vectors have been used to deliver Shiga-toxin antigens, demonstrating their versatility

By combining mdoB modifications with other attenuating mutations and antigen delivery systems, researchers can design vectors with optimized properties for specific vaccination purposes .

What are the current analytical methods for assessing the impact of mdoB mutations on bacterial physiology and virulence?

Researchers employ multiple complementary approaches to assess the effects of mdoB mutations:

Structural analysis methods:

  • Membrane-derived oligosaccharide extraction and characterization:

    • Oligosaccharide isolation through osmotic shock techniques

    • Methylation analysis to determine glucose linkage patterns

    • GLC-MS analysis for detailed structural determination

  • Membrane composition analysis:

    • Isolation of outer membrane proteins (OMPs) and lipopolysaccharides (LPS)

    • SDS-PAGE and immunoblotting techniques

    • Mass spectrometry for detailed compositional analysis

Functional assessment approaches:

  • Growth curve analysis under various conditions:

    • Standard growth in LB medium

    • Growth under osmotic stress (e.g., 6% NaCl)

    • Assessment of bacterial growth kinetics through OD600 measurements

  • Virulence and colonization studies:

    • Animal infection models to assess bacterial tissue distribution

    • Competitive index assays comparing wild-type and mutant strains

    • Histopathological analysis of infected tissues

Immune response evaluation:

  • Measurement of antigen-specific antibody responses (IgG, IgA)

  • Assessment of T-cell responses (IFN-γ, IL-4 production)

  • Evaluation of protection against challenge with virulent strains

What are the current challenges in understanding the complete role of Phosphoglycerol transferase I in Salmonella pathogenesis?

Several challenges persist in fully elucidating mdoB's role in Salmonella pathogenesis:

Methodological limitations:

  • Difficulty in isolating intact membrane protein complexes that may include mdoB

  • Challenges in reconstituting native membrane environments for functional studies

  • Limitations in real-time monitoring of phosphoglycerol transfer in living bacteria

Biological complexity:

  • Redundancy in membrane modification pathways may mask phenotypes of single mutations

  • Host-specific factors affecting mdoB function in different infection models

  • Variable expression under different environmental conditions

Future research approaches:

  • Combined systems biology approaches integrating transcriptomics, proteomics, and metabolomics

  • Development of high-resolution imaging techniques to visualize mdoB-dependent membrane modifications

  • Host-pathogen interaction studies focusing on membrane composition effects on immune recognition

How does antimicrobial resistance development in Salmonella choleraesuis relate to membrane modifications potentially involving mdoB?

Recent research has identified important connections between membrane composition and antimicrobial resistance in Salmonella:

Resistance mechanisms potentially involving membrane modifications:

  • Altered membrane permeability affecting antimicrobial penetration

  • Modified lipopolysaccharide structure influencing interaction with antimicrobial peptides

  • Changes in membrane-derived oligosaccharides affecting cell envelope integrity

Research findings:
A comprehensive study of S. Choleraesuis isolates from humans and animals in Spain (2006-2021) revealed:

  • Multiple drug resistance (MDR) patterns with resistance to aminoglycosides, beta-lactams, quinolones, tetracyclines, and other antimicrobials

  • Significantly higher number of antimicrobial resistance genes in swine isolates compared to human isolates

  • Plasmid-associated resistance genes, particularly on IncHI2/IncHI2A-type plasmids

While the direct involvement of mdoB in these resistance mechanisms remains to be fully elucidated, the enzyme's role in membrane modification suggests potential contributions to the bacterial stress response and adaptation to antimicrobial challenges.

Future research directions:

  • Investigation of mdoB expression changes in response to antimicrobial exposure

  • Assessment of mdoB mutations' impact on antimicrobial susceptibility profiles

  • Exploration of potential interactions between mdoB and known resistance determinants

How does Phosphoglycerol transferase I from Salmonella choleraesuis compare structurally and functionally to its homologs in other bacterial species?

Phosphoglycerol transferase I shows notable conservation across bacterial species with important distinctions:

Structural comparisons:
Computational structural models of Phosphoglycerol transferase I from different Salmonella enterica subspecies show high structural conservation:

  • S. enterica subsp. enterica serovar Dublin: pLDDT global score of 90.89

  • S. enterica subsp. arizonae: pLDDT global score of 90.21

This suggests strong evolutionary pressure to maintain structural features critical for enzyme function.

The E. coli homolog has been more extensively characterized experimentally and shares significant structural and functional similarity with the Salmonella enzyme:

  • Both catalyze the transfer of phosphoglycerol to membrane-derived oligosaccharides

  • Both utilize phosphatidylglycerol as the phosphoglycerol donor

  • The enzymes are localized to the inner membrane with the active site facing the periplasm

Functional conservation and divergence:
While the core enzymatic function is conserved, species-specific differences may exist in:

  • Regulation of gene expression

  • Substrate specificity and kinetic properties

  • Integration with other membrane modification pathways

The mdoB gene in E. coli maps near min 99 on the chromosome, and mutations lead to the production of membrane-derived oligosaccharides lacking phosphoglycerol residues. Similar effects would be expected in Salmonella, though species-specific adaptations may exist .

What insights can be gained from studying the evolutionary conservation of mdoB across Salmonella serovars?

Studying evolutionary conservation of mdoB provides valuable insights into bacterial adaptation:

Phylogenetic analysis:
The OpgG/D family of proteins (which includes proteins related to membrane-derived oligosaccharide synthesis) is present across many proteobacteria. Within this family, two distinct groups can be identified:

  • OpgG orthologs: Typically secreted via the Sec system

  • OpgD orthologs: Often secreted via the Tat (twin-arginine translocation) pathway

This divergence in secretion pathways suggests evolutionary adaptation for different functional roles or cellular localizations.

Implications for pathogenesis and host adaptation:
Conservation analysis of mdoB across Salmonella serovars can reveal:

  • Whether certain serovars have adapted mdoB function for specific host environments

  • Correlations between mdoB sequence variations and virulence in different hosts

  • Potential relationships between membrane modification capabilities and host range

For instance, S. Choleraesuis is host-adapted to swine and causes often-fatal systemic disease, unlike S. typhimurium which has a broader host range . Studying mdoB conservation between these serovars might reveal how membrane modifications contribute to host specificity and pathogenesis patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.