Recombinant Salmonella choleraesuis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; SCH_2303; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
arnE
Target Protein Sequence
MIGIVLVLASLLSVGGQLCQKQATRPLTTGRRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
Facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic side of the inner membrane to the periplasmic side.
Database Links

KEGG: sec:SCH_2303

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of ArnE in Salmonella choleraesuis?

ArnE (formerly known as PmrM) functions as a subunit of an undecaprenyl phosphate-α-L-Ara4N flippase. Its primary role is to translocate 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane . This translocation process is critical in the lipopolysaccharide (LPS) modification pathway, which contributes to antimicrobial peptide resistance in Gram-negative bacteria .

How can researchers express and purify recombinant ArnE for in vitro studies?

Expression and purification of recombinant ArnE requires careful optimization due to its multiple transmembrane domains. Based on protocols used for similar membrane proteins:

  • Expression System Selection: Use bacterial expression systems like E. coli BL21(DE3) with vectors containing T7 promoters. For proper folding, consider C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression.

  • Construct Design: Engineer the construct with a tag (typically His6) for purification, preferably at the C-terminus which is exposed to the periplasm according to topology studies . Consider including a TEV protease cleavage site if tag removal is desired.

  • Expression Conditions:

    • Induce at lower temperatures (16-18°C) to improve proper folding

    • Use lower inducer concentrations (0.1-0.5 mM IPTG)

    • Include membrane-stabilizing agents like glycerol (5-10%) in culture media

  • Membrane Extraction and Solubilization:

    • Extract membranes by ultracentrifugation after cell lysis

    • Solubilize membrane proteins using detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Purification Strategy:

    • Perform immobilized metal affinity chromatography (IMAC)

    • Follow with size exclusion chromatography (SEC) to remove aggregates

    • Maintain detergent concentration above critical micelle concentration throughout purification

The recombinant protein should be stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What experimental approaches can be used to verify ArnE's flippase activity?

Verifying ArnE's flippase activity requires specialized approaches to detect the translocation of lipid-linked substrates across membranes:

  • Everted Membrane Vesicle Assays: Similar to methods used for ECA Wzx flippase characterization, researchers can prepare everted membrane vesicles from cells expressing or depleted of ArnE. Using radiolabeled substrates like 3H-labeled arabinose incorporated into L-Ara4N-phosphoundecaprenol, movement across the membrane can be tracked .

  • Fluorescence-Based Approaches:

    • Reconstitute purified ArnE into liposomes containing fluorescently labeled (e.g., NBD-labeled) L-Ara4N-phosphoundecaprenol analogs

    • Measure fluorescence quenching upon addition of membrane-impermeable quenching agents (e.g., dithionite) to detect translocation

    • Compare results between protein-free liposomes and ArnE-containing liposomes

  • FRET-Based Assays: Develop assays using FRET pairs to detect proximity changes during substrate translocation, similar to approaches used for lipid II flippase studies .

  • Genetic Complementation: Use ArnE knockout strains with polymyxin susceptibility phenotypes and test for restoration of resistance upon introduction of wild-type or mutant ArnE variants .

How can stable expression of ArnE be verified in recombinant Salmonella strains?

To verify stable expression of ArnE in recombinant Salmonella strains, researchers should employ multiple verification methods:

  • Western Blot Analysis: Using polyclonal antibodies against ArnE to detect expression in bacterial lysates. When constructing vaccine strains or expression systems, Western blotting is crucial for confirming the production of target proteins .

  • Plasmid Stability Testing: After serial passages in culture media (approximately 50 passages), perform PCR amplification and restriction enzyme digestion (e.g., with EcoRI and SalI) to confirm the plasmid integrity and maintenance of the arnE gene cassette .

  • Growth Curve Analysis: Compare growth characteristics of recombinant strains with those carrying empty vectors to assess whether the expression of exogenous proteins affects bacterial growth. As observed with other recombinant proteins in Salmonella, the presence of foreign antigens may impact growth kinetics .

  • Motility Assays: Conduct motility tests on appropriate media (with or without inducers like arabinose) to ensure recombinant protein expression doesn't impair bacterial motility, which could affect in vivo applications .

  • PCR Verification: Design primers specific to the arnE gene and perform PCR to confirm its presence in isolated colonies after multiple generations .

What is the relationship between ArnE/ArnF and antibiotic resistance in Salmonella?

The ArnE/ArnF (formerly PmrL/PmrM) proteins are critical components of the lipid A modification pathway that contributes significantly to antimicrobial peptide resistance:

How can ArnE be utilized in the development of attenuated Salmonella vaccine vectors?

ArnE can be strategically incorporated into attenuated Salmonella vaccine development through several approaches:

  • Regulated Expression Systems: Using the knowledge of ArnE's role in LPS modification, researchers can develop regulated expression systems where ArnE expression is conditionally controlled to modulate bacterial attenuation and immunogenicity .

  • Vector Design Strategies:

    • Balanced Lethal Systems: Implement balanced lethal systems that ensure the stability of plasmids carrying ArnE and foreign antigens, similar to approaches used in rSC0016 Salmonella Choleraesuis vaccine vectors

    • Regulated Delayed Attenuation: Design vectors with regulated delayed attenuation that balance safety and immunogenicity, controlling ArnE expression alongside other virulence factors

    • Delayed Antigen Synthesis: Couple ArnE modification with delayed antigen synthesis to optimize immune responses

  • Immune Response Optimization: The modification of lipid A through the pathway involving ArnE affects the immunostimulatory properties of LPS. This can be leveraged to:

    • Reduce host intestinal inflammatory responses (similar to sopB gene knockout approaches)

    • Create optimal adjuvant effects for co-delivered antigens

    • Balance between safety and immunogenicity

  • Protection Assessment Protocol:
    When evaluating vaccine candidates incorporating ArnE modifications, researchers should employ the following protocol:

    Assessment ParameterMeasurement MethodExpected Outcome for Effective Vaccine
    Mucosal ImmunityIgA antibody titers in mucosal secretionsSignificantly elevated compared to control
    Humoral ImmunitySerum IgG levelsMixed Th1/Th2-type response
    Cellular ImmunityIL-4 and IFN-γ levelsIncreased compared to control
    Lymphocyte ProliferationCell proliferation assayEnhanced proliferation
    Protection EfficacyChallenge with virulent strainsReduced clinical symptoms, pathological damage, and inflammatory cell infiltration

The rSC0016 S. Choleraesuis attenuated vector, which has been successfully used for expressing heterologous antigens, provides a model system for incorporating ArnE-based strategies in vaccine development .

What experimental challenges arise when studying the interaction between ArnE and ArnF in the flippase complex?

Studying the ArnE-ArnF interaction within the flippase complex presents several experimental challenges:

  • Membrane Protein Complex Isolation:

    • Maintaining the native interaction during solubilization requires screening multiple detergents

    • Co-purification protocols must preserve the stoichiometry and association of both subunits

    • Cross-linking approaches may be needed to stabilize transient interactions

  • Functional Reconstitution Difficulties:

    • Reconstituting the active ArnE-ArnF complex into liposomes with proper orientation is technically demanding

    • Unlike single membrane proteins, ensuring both proteins are incorporated with correct stoichiometry adds complexity

    • Confirming that reconstituted complexes retain native flippase activity requires specialized assays

  • Structural Characterization Barriers:

    • Membrane protein complexes present significant hurdles for structural biology techniques

    • Cryo-EM approaches may require larger complexes or fusion partners for particle identification

    • Crystallization is complicated by detergent micelles and the dynamic nature of the complex

  • Distinguishing Individual Contributions:

    • Determining the specific roles of ArnE versus ArnF within the complex requires targeted mutagenesis

    • Complementation studies with individual protein variants are needed to assess functional contributions

    • Domain swapping between related flippases can help identify interaction interfaces and functional regions

  • Substrate Specificity Assessment:

    • Synthesizing the natural substrate (undecaprenyl phosphate-α-L-Ara4N) in sufficient quantities for biochemical studies is challenging

    • Developing substrate analogs that maintain specificity while incorporating detectable labels requires organic synthesis expertise

    • Controls to distinguish genuine flipping activity from substrate leakage or non-specific transport are essential

How does the ArnE pathway interact with other resistance mechanisms in multi-drug resistant Salmonella strains?

The interaction between the ArnE pathway and other resistance mechanisms in multi-drug resistant Salmonella involves complex regulatory networks and functional overlaps:

To study these interactions experimentally, researchers should employ combination gene knockout approaches, transcriptomic analyses under different stress conditions, and phenotypic assays that can detect subtle changes in resistance profiles.

What novel methodologies could advance the study of ArnE translocation mechanisms?

Several cutting-edge approaches could significantly advance our understanding of ArnE translocation mechanisms:

  • Advanced Imaging Techniques:

    • Single-molecule FRET (smFRET): Labeling ArnE at specific sites with FRET pairs could allow real-time observation of conformational changes during the translocation cycle

    • High-speed atomic force microscopy (HS-AFM): This could visualize ArnE structural dynamics in lipid bilayers under near-physiological conditions

    • Cryo-electron tomography: Applied to bacterial membrane preparations to visualize ArnE in its native membrane environment

  • Nanodiscs and Synthetic Biology Approaches:

    • Reconstituting ArnE into nanodiscs would provide a more native-like membrane environment than detergent micelles

    • Minimal synthetic cells with defined lipid composition could isolate the flippase function from other cellular processes

    • Designer substrates with spectroscopic properties could track translocation events with greater precision

  • Computational Methods:

    • Molecular dynamics simulations: Using the predicted 13-transmembrane structure , simulate substrate binding and translocation

    • Deep learning approaches: Train models to predict interaction sites between ArnE, ArnF, and their substrate

    • Evolutionary coupling analysis: Identify co-evolving residues that might form functional interaction networks

  • Genetic Code Expansion Technologies:

    • Incorporate unnatural amino acids at specific positions to introduce bioorthogonal handles for site-specific labeling

    • Use photo-crosslinking amino acids to capture transient interactions with substrates or partner proteins

    • Employ amber suppression technology to introduce spectroscopic probes at defined positions

  • Microfluidic Approaches:

    • Develop microfluidic systems to study single-vesicle translocation events

    • Create gradient-forming devices to investigate how different environments affect ArnE function

    • Combine with droplet-based assays for high-throughput screening of conditions or mutations affecting activity

How might structural characterization of ArnE inform the development of novel antimicrobial strategies?

Structural characterization of ArnE could open several avenues for antimicrobial development:

  • Structure-Based Inhibitor Design:

    • Identification of substrate binding pockets and catalytic sites would enable the rational design of competitive inhibitors

    • Understanding the ArnE-ArnF interface could lead to peptide inhibitors that disrupt complex formation

    • Characterization of conformational changes during translocation could reveal opportunities for allosteric inhibitors

  • Membrane-Targeted Approaches:

    • Structural insights into how ArnE interacts with membrane lipids could inform the development of membrane-active compounds that selectively disrupt this interaction

    • Lipid-like molecules that compete with the natural substrate but cannot be translocated could act as effective inhibitors

    • Understanding the lipid requirements for ArnE function might reveal how to disrupt its activity through membrane composition alterations

  • Drug Delivery Strategies:

    • Knowledge of the translocation mechanism could potentially be repurposed to design drug delivery systems that utilize similar principles to traverse bacterial membranes

    • Understanding how substrates are recognized and flipped could inform the design of antimicrobial conjugates that hijack this machinery

  • Antimicrobial Resistance Prediction:

    • Structural mapping of natural variations in ArnE across bacterial species could help predict and counter emerging resistance mechanisms

    • Identification of structural elements essential for function versus those that can tolerate variation would highlight the most promising conserved targets

  • Potential Impact of Structural Insights on Antimicrobial Development:

    Structural FeaturePotential Antimicrobial ApproachExpected Advantages
    Substrate binding pocketCompetitive inhibitorsHigh specificity, direct blockade of function
    ArnE-ArnF interfaceProtein-protein interaction inhibitorsNovel target, potentially lower resistance development
    Transmembrane helicesMembrane-disruptive peptidesCould affect multiple membrane proteins simultaneously
    Conformational transition sitesAllosteric inhibitorsMay be effective at lower concentrations
    Conserved catalytic residuesMechanism-based inactivatorsHigh potency, potential broad-spectrum activity

The research by Tavares-Carreón et al. on ArnT topology and essential residues provides a foundation for similar structural studies on ArnE that could accelerate these antimicrobial development approaches .

What are the most common challenges when working with recombinant Salmonella choleraesuis strains expressing ArnE?

Researchers working with recombinant S. choleraesuis expressing ArnE face several technical challenges:

  • Expression Level Optimization:

    • Challenge: Overexpression of membrane proteins like ArnE can be toxic to bacterial cells

    • Solution: Use tightly regulated inducible promoters (like araBAD) with careful titration of inducer concentrations

    • Verification: Monitor growth curves with different induction protocols to identify optimal conditions that balance expression and cell viability

  • Genetic Stability Issues:

    • Challenge: Plasmids carrying arnE may be lost during prolonged culturing

    • Solution: Implement balanced-lethal systems (such as asd-based plasmid maintenance in Δasd strains) to ensure plasmid retention

    • Verification: Regularly perform PCR and restriction enzyme analysis after serial passages (approximately 50 generations) to confirm plasmid retention

  • Biological Containment Concerns:

    • Challenge: Working with attenuated but potentially immunogenic Salmonella strains requires appropriate containment

    • Solution: Utilize multiple chromosomal deletions (ΔaroA, ΔsopB) to ensure strain attenuation while maintaining the regulated delayed attenuation system

    • Verification: Confirm attenuation through mouse virulence studies and absence of tissue dissemination beyond expected compartments

  • Protein Folding and Functionality:

    • Challenge: Ensuring proper folding and membrane integration of recombinant ArnE

    • Solution: Include native signal sequences and avoid N-terminal tags that might interfere with membrane insertion

    • Verification: Conduct functional assays (e.g., polymyxin resistance testing) to confirm that expressed ArnE is functionally active

  • Storage and Revival Procedures:

    • Challenge: Maintaining viability during storage and avoiding genetic drift

    • Solution: Store multiple aliquots in 50% glycerol at -80°C and minimize passages after revival

    • Verification: Compare protein expression and functional characteristics before and after storage to ensure consistency

By addressing these common challenges with the suggested solutions and verification steps, researchers can significantly improve the reliability and reproducibility of experiments involving recombinant S. choleraesuis expressing ArnE.

How should researchers interpret conflicting experimental results regarding ArnE function?

When faced with conflicting experimental results regarding ArnE function, researchers should employ a systematic approach to interpretation:

  • Methodological Considerations:

    • Different Assay Sensitivities: Compare detection limits and dynamic ranges of different assays. For example, radioactive assays may detect subtle changes in flippase activity that fluorescence-based methods might miss .

    • In Vitro vs. In Vivo Discrepancies: Consider that reconstituted systems using purified components may not fully recapitulate the complex environment of the bacterial membrane. Similar conflicting results have been observed with other flippases like FtsW and MurJ .

    • Substrate Variations: Assess whether studies used the natural substrate or analogs. For instance, the use of Nerol-P (a shorter analog of undecaprenyl phosphate) might yield different results than the natural substrate .

  • Genetic Background Effects:

    • Compensatory Mechanisms: Investigate whether the genetic background of the strains used might allow for redundant transporters or alternative pathways.

    • Pleiotropy Analysis: Determine whether observed phenotypes are directly related to ArnE function or are pleiotropic effects of genetic manipulations.

    • Strain-Specific Variations: Consider that natural variations in ArnE sequence or expression levels between strains might influence experimental outcomes.

  • Protein-Protein Interaction Context:

    • Complex Formation Requirements: Evaluate whether studies addressed the potential requirement for ArnE and ArnF to function together as a complex .

    • Accessory Protein Involvement: Consider the possible role of additional, unidentified proteins that might be required for full activity in some contexts but not others.

  • Systematic Analysis Framework:

    Type of ConflictAnalysis ApproachResolution Strategy
    Activity DetectionCompare sensitivity and specificity of different assaysPerform side-by-side comparisons using multiple methods on the same samples
    Substrate SpecificityEvaluate structural differences between substrates usedTest activity with the most physiologically relevant substrate
    Genetic RequirementAssess completeness of genetic knockouts/complementationUse clean deletion mutants and controlled complementation
    Physiological ImpactDistinguish direct vs. indirect effectsUse time-course and condition-specific experiments
    Strain DifferencesAnalyze genetic context of experimentsTest hypotheses across multiple strains
  • Integration of Multiple Lines of Evidence:

    • Weigh evidence based on methodological rigor, reproducibility, and physiological relevance

    • Consider evolutionary conservation data to help resolve conflicting functional assignments

    • Use systems biology approaches to place conflicting results in broader pathway contexts

When interpreting conflicting results, researchers should remember that membrane protein function characterization is inherently challenging, and apparent contradictions may reflect different aspects of complex multifunctional proteins rather than actual errors.

What biosafety and regulatory considerations apply to research with recombinant Salmonella choleraesuis strains expressing ArnE?

Research with recombinant S. choleraesuis strains expressing ArnE requires adherence to specific biosafety and regulatory frameworks:

  • Biosafety Level Requirements:

    • Wild-type S. choleraesuis is typically handled at Biosafety Level 2 (BSL-2)

    • Recombinant strains generally maintain this classification, but risk assessment should consider:

      • The nature of genetic modifications and their impact on virulence

      • The presence of antibiotic resistance markers

      • The expression of heterologous proteins that might alter pathogenicity

    • Work should be conducted in appropriate containment facilities with biosafety cabinets and trained personnel

  • Attenuated Strain Documentation:

    • For attenuated vaccine vector strains (like rSC0016), documentation of attenuating mutations is essential

    • Evidence of biological containment should include:

      • Genetic stability analysis through multiple passages

      • In vivo attenuation data in appropriate animal models

      • Dissemination and persistence studies showing limited spread beyond intended tissues

  • Dual-Use Research of Concern (DURC) Assessment:

    • Research involving LPS modification systems like ArnE may require DURC evaluation since such modifications can affect antibiotic resistance

    • Investigators should consult institutional biosafety committees to determine if additional oversight is needed

    • Publications may need to address potential dual-use concerns and describe appropriate safeguards

  • Animal Research Protocols:

    • Studies involving animal models must comply with:

      • Institutional Animal Care and Use Committee (IACUC) approval

      • The 3Rs principles (Replacement, Reduction, Refinement)

      • Special considerations for infectious disease models

    • For vaccine studies, clear endpoints and humane monitoring protocols are essential

  • Regulatory Pathway Considerations for Translational Research:

    • If pursuing vaccine development, early consultation with regulatory authorities is advisable

    • Development plans should address:

      • Genetic stability of attenuating mutations

      • Prevention of reversion to virulence

      • Absence of horizontal gene transfer

      • Environmental risk assessment for shedding and persistence

By proactively addressing these considerations, researchers can ensure compliance with regulations while advancing important work on ArnE and its potential applications in vaccine development or antimicrobial resistance studies.

How should researchers validate the specificity of anti-ArnE antibodies for immunological studies?

Validating anti-ArnE antibodies for immunological studies requires a comprehensive approach to ensure specificity and reliability:

  • Initial Characterization:

    • Western Blot Analysis: Test antibodies against purified recombinant ArnE, both tagged and untagged versions

    • Multiple Species Testing: Verify specificity using ArnE from different bacterial species (S. choleraesuis, B. cenocepacia, P. aeruginosa) to assess cross-reactivity

    • Size Verification: Confirm that the detected band corresponds to the predicted molecular weight of ArnE (~13 kDa based on sequence)

  • Negative Controls:

    • Knockout Validation: Test antibodies against extracts from arnE deletion strains

    • Pre-immune Serum Comparison: Compare staining with pre-immune serum to identify non-specific binding

    • Peptide Competition: Perform blocking experiments with the immunizing peptide to confirm epitope specificity

  • Membrane Protein-Specific Considerations:

    • Detergent Optimization: Test different detergent extraction methods to maintain ArnE's native structure

    • Aggregation Assessment: Evaluate potential for antibody to recognize aggregated forms of ArnE

    • Fixation Sensitivity: For immunohistochemistry, determine if fixation methods affect epitope recognition

  • Cross-Reactivity Assessment:

    • Homologous Proteins: Test against related membrane proteins (ArnF, other flippases)

    • Proteomics Verification: Perform immunoprecipitation followed by mass spectrometry to identify all bound proteins

    • Array Testing: If possible, test against protein arrays containing similar membrane proteins

  • Validation Checklist for Publication:

    Validation ParameterExperimental ApproachAcceptance Criteria
    SpecificityWestern blot against recombinant proteinSingle band at expected molecular weight
    SensitivitySerial dilution detectionConsistent detection at relevant expression levels
    Genetic ValidationTesting in knockout strainAbsence of signal in knockout
    Epitope MappingPeptide competition assays>80% signal reduction with specific peptide
    ReproducibilityInter-lot testingConsistent results across antibody preparations
    Cross-reactivityTesting against homologous proteinsMinimal binding to non-target proteins
  • Application-Specific Validation:

    • For immunoprecipitation: Verify pull-down efficiency with Western blot

    • For immunofluorescence: Confirm membrane localization pattern

    • For ELISA: Establish standard curves with purified protein

Researchers should note that polyclonal antibodies against ArnE have been used successfully for Western blot analysis of recombinant strains , providing a precedent for successful antibody development against this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.