Recombinant Salmonella choleraesuis Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Salmonella choleraesuis Probable Intracellular Septation Protein A (yciB) is a genetically engineered protein derived from S. choleraesuis strain SC-B67. It is implicated in bacterial cell division and membrane integrity, though its exact mechanistic role remains under investigation. This protein is utilized in research applications, including immunological assays, due to its recombinant availability .

Role in Cell Envelope Integrity

  • In Escherichia coli, YciB synergizes with DcrB to maintain membrane fluidity and lipoprotein maturation. Deletion of both proteins impairs Lgt-mediated lipid modification, leading to toxic lipoprotein mislocalization .

  • Homology modeling suggests Salmonella yciB may similarly stabilize membrane architecture, particularly under stress conditions (e.g., low temperature or high salt) .

Septation and Cell Division

  • The designation "septation protein" implies a role in bacterial cell division, though experimental validation in Salmonella is pending. In Bacillus subtilis, septation proteins regulate Z-ring formation during cytokinesis .

Immunological Assays

Recombinant yciB is commercially available for ELISA development, enabling:

  • Detection of Salmonella-specific antibodies in host sera.

  • Study of immune responses during S. choleraesuis infection .

Vaccine Development

While not directly used in current Salmonella vaccine vectors (e.g., C500 or C522 strains) , yciB’s role in membrane homeostasis makes it a potential target for attenuation strategies.

Comparative Analysis with E. coli YciB

FeatureS. choleraesuis yciBE. coli YciB
Gene ContextSCH_1731 locusyciB (b2210) in conserved operon
FunctionPutative septation, membrane integrityMembrane homeostasis, Lgt activity regulation
Mutant PhenotypeNot reportedSynthetic lethality with ΔdcrB
Structural Homology81% identity (N-terminal HTH domain) Includes lipid-binding motifs

Outstanding Questions and Future Directions

  1. Mechanistic Role: Does yciB directly participate in septation, or does it indirectly influence division via membrane fluidity?

  2. Pathogenicity Link: How does yciB contribute to S. choleraesuis virulence during systemic infection?

  3. Therapeutic Potential: Could yciB inhibition disrupt Salmonella cell division or envelope integrity?

References (Integrated Citations)

  • Structural and commercial data: .

  • Functional insights from E. coli homologs: .

  • Genomic context and regulation: .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; SCH_1731; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links

KEGG: sec:SCH_1731

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant yciB protein preparations?

For maintaining stability and activity of recombinant yciB, the following storage conditions are recommended:

Storage ParameterRecommended ConditionNotes
Short-term storage4°CViable for up to one week
Long-term storage-20°CStandard for most experiments
Extended storage-80°CRecommended for preserving activity beyond 6 months
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Handling precautionAvoid repeated freeze-thaw cyclesCompromises protein integrity

These conditions are optimized to maintain the structural integrity and functional properties of the recombinant protein for experimental applications .

How is yciB expressed in heterologous systems for research purposes?

Recombinant yciB is typically expressed using balanced-lethal host-vector systems, such as the Asd+ system. This approach involves:

  • Cloning the full-length yciB gene (expression region 1-179) into an appropriate expression vector

  • Transforming the construct into an Asd-deficient host strain

  • Inducing expression under controlled conditions to ensure proper protein folding

  • Purifying the protein using affinity chromatography based on the tag determined during the production process

This method allows for stable maintenance of the recombinant plasmid without antibiotic selection pressure, which is particularly advantageous for vaccine development applications .

What approaches are most effective for studying yciB function in Salmonella pathogenesis?

To investigate yciB's role in Salmonella pathogenesis, researchers should implement a multi-faceted approach:

  • Gene knockout studies: Create ΔyciB mutants using techniques like lambda Red recombinase system to assess phenotypic changes.

  • Complementation analysis: Reintroduce wild-type or mutated yciB on plasmids to confirm phenotype restoration.

  • Protein localization studies: Use fluorescent protein fusions or immunolocalization to determine subcellular distribution during infection.

  • Interaction studies: Employ pull-down assays or bacterial two-hybrid systems to identify protein partners.

  • Virulence assessments: Compare colonization abilities between wild-type and mutant strains in appropriate animal models.

Researchers should be cautious about potential polar effects when creating mutations and consider using in-frame deletions to minimize disruption of downstream genes .

How can recombinant yciB be incorporated into novel vaccine development strategies?

Recombinant yciB can be strategically incorporated into vaccine development through several approaches:

  • Balanced-lethal vector systems: Utilize Asd+ vectors like pYA3493 to maintain stable expression without antibiotic selection, which is critical for in vivo applications.

  • Subcellular targeting: Direct yciB to specific compartments (cytoplasmic, periplasmic, or surface-displayed) to optimize immune recognition.

  • Fusion with immunostimulatory domains: Engineer chimeric proteins containing yciB and immunogenic epitopes from other pathogens.

  • Regulated expression systems: Implement arabinose-inducible promoters (araC PBAD) to control antigen expression levels in vivo.

  • Attenuated delivery strains: Introduce mutations in virulence genes (such as ΔrfbP, ΔpagL, Δcrp, Δcya) to create safe vaccine vectors that still effectively colonize lymphoid tissues.

This approach has shown promise in experimental vaccines, where recombinant Salmonella strains expressing heterologous antigens induced robust immune responses against multiple pathogens simultaneously .

What immunological parameters should be measured when evaluating vaccines based on recombinant Salmonella expressing yciB?

A comprehensive immunological assessment of recombinant Salmonella vaccines expressing yciB should include:

Immune ParameterMethodologySignificance
Serum IgGELISA against purified yciBIndicates systemic humoral response
Mucosal IgAFecal or intestinal lavage sampling for ELISAMeasures local mucosal immunity
T-cell responsesELISpot for IFN-γ, IL-4, IL-17Evaluates Th1/Th2/Th17 balance
Bactericidal activitySerum killing assaysAssesses functional antibody efficacy
Cytokine profileCytometric bead arrayCharacterizes inflammatory response
Protection efficacyChallenge studies with virulent strainsUltimate measure of vaccine effectiveness

Studies with similar recombinant Salmonella vaccines showed that protective immunity correlates with balanced Th1/Th2 responses and high levels of both systemic IgG and mucosal IgA antibodies. For example, mice immunized with recombinant attenuated Salmonella expressing heterologous antigens demonstrated 80% survival rates compared to 60% for traditional inactivated vaccines when challenged with virulent strains .

How should researchers address unexpected results or data contradictions when working with recombinant yciB?

When confronting contradictory data in yciB research, implement this systematic approach:

  • Verify protein expression: Confirm recombinant yciB is properly expressed and correctly folded using Western blotting and functional assays.

  • Examine experimental variables: Systematically review:

    • Growth conditions (temperature, media composition)

    • Induction parameters (timing, concentration)

    • Host strain characteristics (genetic background)

  • Evaluate purification efficiency: Assess protein purity and potential degradation through SDS-PAGE and mass spectrometry.

  • Consider alternative hypotheses: Be willing to revise working models about yciB function based on unexpected findings.

  • Control for confounding factors: Implement additional controls to identify variables affecting experimental outcomes:

Potential Confounding FactorControl Strategy
Host strain variabilityUse isogenic strains differing only in yciB status
Plasmid stabilityMeasure plasmid retention rates over time
Expression levelsQuantify protein expression by quantitative Western blot
Contaminating proteinsPerform additional purification steps

Remember that unexpected results often lead to new discoveries, as demonstrated in multiple studies where contradictory findings ultimately revealed novel aspects of bacterial protein function .

What are the critical considerations for optimizing recombinant plasmid stability in Salmonella vaccine strains?

Ensuring plasmid stability in recombinant Salmonella vaccine vectors requires addressing several factors:

  • Selection system choice: The Asd+ balanced-lethal system demonstrates superior stability compared to antibiotic resistance markers. Studies showed that recombinant pYA-PmtC plasmid maintained "very stable" expression in strain C501, with minimal loss after multiple passages .

  • Copy number optimization: Balance expression levels with metabolic burden using appropriate origins of replication.

  • Promoter selection: Consider using regulated promoters like araC PBAD that can be controlled in vivo.

  • Insert size management: Larger inserts tend to reduce stability; minimize construct size when possible.

  • Growth conditions: Optimize temperature, media composition, and growth phase for harvesting.

  • Compatibility with mutations: Ensure attenuating mutations (Δasd, ΔrfbP, ΔpagL) don't negatively impact plasmid maintenance.

Research has shown that combining these approaches can achieve plasmid stability exceeding 95% after 30 generations without selection, which is critical for in vivo vaccine applications .

What animal models are most appropriate for evaluating Salmonella choleraesuis vaccines expressing recombinant proteins?

Selecting appropriate animal models for Salmonella vaccine testing requires consideration of natural host susceptibility and immune response characteristics:

  • Mouse models (BALB/c):

    • Advantages: Well-characterized genetics, cost-effective, numerous immunological reagents available

    • Applications: Initial immunogenicity studies, dose optimization, preliminary safety assessment

    • Limitations: Different susceptibility pattern compared to natural hosts

    • Protocol: Typically administered 10^9 CFU orally, twice at 4-week intervals, followed by challenge with 100× LD50 of virulent strains

  • Porcine models:

    • Advantages: Natural host for S. choleraesuis, translational relevance

    • Applications: Definitive efficacy studies, safety assessment, duration of immunity

    • Protocols: Similar to those used for commercial vaccine testing

    • Observations: Studies demonstrated that piglets inoculated with recombinant vaccine strain C501 (pYA-PmtC) survived with no signs of disease

  • Heterologous protection models:

    • For vaccines targeting multiple pathogens (e.g., S. choleraesuis and P. multocida)

    • Requires challenge with both pathogens to assess cross-protection

When designing animal studies, researchers should carefully consider ethical guidelines, statistical power, and appropriate endpoints to minimize animal use while obtaining scientifically valid data .

What emerging technologies might enhance the efficacy of recombinant Salmonella vaccines expressing yciB?

Several cutting-edge approaches show promise for improving recombinant Salmonella vaccine platforms:

  • CRISPR-Cas9 genome editing: Enables precise modification of bacterial genomes to:

    • Create defined deletion mutations without antibiotic resistance markers

    • Integrate expression cassettes into chromosomal loci for greater stability

    • Fine-tune expression levels through promoter engineering

  • Synthetic biology approaches:

    • Codon optimization of heterologous antigens for enhanced expression

    • Design of synthetic promoters with tailored strength and regulation

    • Construction of genetic circuits for programmed antigen delivery

  • Novel adjuvant strategies:

    • Co-expression of immunomodulatory molecules

    • Engineering of modified lipopolysaccharide structures

    • Surface display of complement-targeting molecules

  • Advanced delivery systems:

    • Regulated lysis systems for controlled antigen release

    • Biofilm-based vaccine formulations for extended antigen presentation

    • Bacterial outer membrane vesicles as non-living vaccine carriers

These approaches may address current limitations in recombinant Salmonella vaccines, potentially enhancing immunogenicity while maintaining safety profiles .

How might researchers leverage heterologous antigen expression systems to develop multivalent vaccines?

The development of multivalent Salmonella vaccines through heterologous antigen expression represents a promising frontier in vaccine research:

  • O-antigen exchange strategy: Following the approach demonstrated with S. Typhimurium expressing S. Choleraesuis O-antigens, researchers could:

    • Clone O-antigen gene clusters from multiple serovars

    • Express them in an attenuated backbone strain

    • Generate protection against multiple Salmonella serovars simultaneously

  • Multiple antigen expression systems:

    • Utilize different compatible plasmids with varied copy numbers

    • Employ chromosomal integration at multiple sites

    • Design polycistronic constructs with optimized translation signals

  • Cross-species protection strategies:

    • Express protective antigens from multiple pathogens (as demonstrated with S. Choleraesuis expressing P. multocida toxin)

    • Target pathogens that share ecological niches (e.g., respiratory or intestinal)

    • Focus on conserved antigens with cross-protective potential

Research has demonstrated that bivalent vaccines can induce protective immunity against both the vector strain and heterologous pathogens, with protection rates of 80% against challenge infections, significantly outperforming traditional vaccines .

What challenges remain in translating recombinant Salmonella vaccine research to clinical applications?

Despite promising results in experimental models, several challenges must be addressed before recombinant Salmonella vaccines reach clinical application:

  • Safety considerations:

    • Ensuring complete attenuation without reversion to virulence

    • Managing potential horizontal gene transfer

    • Addressing safety in immunocompromised populations

  • Regulatory hurdles:

    • Genetically modified organism (GMO) regulations

    • Requirements for characterization of recombinant constructs

    • Need for defined genetic systems with minimal antibiotic resistance markers

  • Technical limitations:

    • Balancing attenuation with immunogenicity

    • Maintaining genetic stability in production and after administration

    • Controlling antigen expression levels in vivo

  • Immunological challenges:

    • Pre-existing immunity to the Salmonella vector

    • Variability in host immune responses

    • Need for appropriate adjuvanting strategies

Researchers should focus on developing second-generation recombinant Salmonella platforms with enhanced safety features, including multiple independent attenuating mutations and environmentally responsive regulatory systems to address these challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.