Recombinant Salmonella choleraesuis Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs

In Stock

Cat. No.

BT2494352

Source

in vitro E.coli expression system

Synonyms

ubiB; SCH_3870; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB

Quick Inquiry

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time

Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.

Shelf Life

Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.

Synonyms

ubiB; SCH_3870; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-546

Protein Length

full length protein

Species

Salmonella choleraesuis (strain SC-B67)

Target Names

ubiB

Target Protein Sequence

MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR

Uniprot No.

Q57HN6

Target Background

Function

This protein is likely a kinase regulator of UbiI, an enzyme involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links

KEGG: sec:SCH_3870

Protein Families

ABC1 family, UbiB subfamily

Subcellular Location

Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

How can researchers optimize antigen expression levels in recombinant Salmonella Choleraesuis?

Optimizing antigen expression requires balancing sufficient production for immunogenicity while minimizing metabolic burden:

Optimization Strategy	Methodological Approach	Considerations
Promoter selection	Test constitutive vs. inducible promoters Compare in vitro and in vivo expression	"Use of regulated promoter systems like the arabinose-inducible PBAD promoter"
Codon optimization	Adapt codons to S. Choleraesuis preference Analyze GC content and rare codons	Enhances translation efficiency and protein yield
Signal sequence engineering	Test Sec vs. TAT pathway signals Optimize secretion efficiency	"Synthesize and secrete the surface protein"
Plasmid copy number	Compare different origins of replication Balance expression vs. metabolic burden	Plasmids like pYA3493 and pYA3943 with pBR origin
Expression timing	Evaluate early vs. delayed expression Use environmentally-responsive promoters	"Regulated delayed exogenous synthesis system"

The search results highlight a critical consideration: "Foreign antigen expression may influence the growth capacity of the rSC0016 vector" , indicating the need to carefully balance expression with vector fitness.

What strategies exist to reduce reactogenicity while maintaining immunogenicity in Salmonella vaccine vectors?

Achieving the optimal balance between safety and efficacy is crucial for vaccine development:

Attenuation Strategy	Mechanism	Effect on Balance
Regulated delayed attenuation	Gradual attenuation after colonization Examples: ΔPcrp527::TT araC PBAD crp ΔPfur88::TT araC PBAD fur	"Achieving the proper balance between immunogenicity and attenuation" "Sufficient metabolic activity should be maintained to enable the live vaccine to reach deep lymphatic tissues"
Virulence factor deletion	Removal of specific inflammatory mediators Example: ΔsopB	"Incorporating a sopB mutation" to reduce reactogenicity
Multiple independent mutations	Combinatorial attenuation approach Prevents reversion to virulence	"Multiple independent defined mutations were introduced into Salmonella"
Metabolic engineering	Targeting non-essential pathways Example: Δpmi-2426	Contributes to attenuation while preserving immunogenicity
Fur regulation	Controls iron acquisition systems Affects acid tolerance	"A S. Typhimurium strain with an arabinose regulated fur mutation is adequately attenuated and highly immunogenic"

The search results specifically address this challenge: "A live-attenuated S. Choleraesuis vaccine candidate strain rSC0011 occasionally lead to morbidity (enteritidis) in vaccinated mice," necessitating development of strain rSC0012 with fur-based attenuation .

How do mutations in the fur gene affect the balance between attenuation and immunogenicity of Salmonella vectors?

The fur gene (ferric uptake regulator) plays a multifaceted role in balancing attenuation and immunogenicity:

Aspect	Fur Function	Impact on Vaccine Vector
Iron homeostasis	Regulates iron acquisition genes Controls iron storage	Affects bacterial growth in iron-limited host environments
Acid tolerance	"Fur mutants are acid sensitive" "Altered expression of acid shock proteins"	Reduces survival during gastrointestinal passage while allowing sufficient colonization
Stress responses	Coordinates responses to oxidative stress Influences resistance to host defenses	Increases susceptibility to host clearance mechanisms
Virulence regulation	Modulates expression of virulence factors Affects pathogenicity island expression	Attenuates virulence while preserving immunogenicity
Regulated attenuation	"ΔPfur88::TT araC PBAD fur" Arabinose-dependent expression	Allows controlled attenuation after vaccination

The research demonstrated that applying this fur-based system to S. Choleraesuis (strain rSC0012) provided "another way to improve the S. Choleraesuis vector" specifically to address reactogenicity issues while maintaining sufficient immunogenicity .

What methodologies are used to evaluate tissue distribution and persistence of recombinant Salmonella vaccines?

Rigorous assessment of vaccine vector distribution requires systematic methodological approaches:

Methodology Component	Experimental Details	Purpose
Animal model selection	"Three-week-old female BALB/c mice" "Mice were divided into 7 groups with 25 mice in each group"	Standardized model for reproducible results
Administration protocol	"Each mouse was orally inoculated with 1 ± 0.2 × 10^9 CFU" Defined growth conditions and preparation	Consistent dosing for comparative analysis
Tissue sampling strategy	"Peyer's patches, spleen, and liver" Collection "on days 3, 7, 14, 21 and 28 post-inoculated"	Comprehensive assessment of mucosal and systemic distribution
Bacterial enumeration	Tissue homogenization and dilution plating Colony counting on selective media	Quantitative assessment of bacterial burden in tissues
Statistical analysis	"The assay was performed twice, and the data were similar and pooled for analysis"	Robust evaluation through experimental replication
Correlation with immunity	Parallel immune parameter analysis "50 μL of whole blood was collected by tail vein"	Linking distribution patterns with immune response development

These methodologies collectively provide a comprehensive picture of how recombinant Salmonella vaccines distribute throughout host tissues, how long they persist, and how this correlates with protective immunity development.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Salmonella choleraesuis Probable ubiquinone biosynthesis protein UbiB (ubiB)

Product Specs

Target Background

Q&A

Advanced Research Questions

Quick Inquiry

Category

Service