Recombinant Salmonella choleraesuis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Lgt and Its Role in Bacterial Physiology

Lipoproteins are essential for bacterial membrane structure and function, anchoring proteins to the inner or outer membrane. Lgt catalyzes the first step in lipoprotein biogenesis by transferring a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in prolipoproteins, enabling membrane anchoring . In Salmonella species, lipoproteins are critical for virulence, stress response, and nutrient uptake .

Key Features of Salmonella choleraesuis Lgt

PropertyDescriptionSource
Gene OriginChromosomal lgt gene from S. choleraesuis strain SC-B67
Protein LengthFull-length protein (residues 1–291)
TagN-terminal 10xHis-tag for purification and detection
Expression SystemE. coli in vitro system

Catalytic Mechanism

Lgt facilitates the attachment of a diacylglyceryl group to the +1 cysteine of preprolipoproteins via a thioether bond, enabling their translocation to bacterial membranes . This modification is essential for lipoprotein function, as unmodified lipoproteins accumulate in the cytoplasm and disrupt cellular processes .

Sequence and Domains

The recombinant Lgt protein includes the full-length sequence of S. choleraesuis Lgt:

Sequence RegionAmino Acids
N-terminalMTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL
Central DomainLYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMII FARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSHPQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGALRIIVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
C-terminal... (remaining residues up to 291)

This sequence includes conserved motifs critical for enzymatic activity, though specific catalytic residues remain undefined .

Production and Purification

The recombinant Lgt is produced via heterologous expression in E. coli, leveraging a plasmid-based system for high-yield production .

Production ParameterSpecificationSource
Host StrainE. coli (in vitro system)
Purification MethodAffinity chromatography (His-tag binding)
PurityNot explicitly stated; likely >90%
Storage-20°C (stable for 6–12 months)

Role in Lipoprotein Biogenesis

Impact on Pathogenicity

  • Virulence Attenuation: Lipoproteins are key virulence factors in Salmonella. Deletion of Lgt or lipoprotein genes reduces bacterial survival in host cells and induces protective immune responses .

  • Cytokine Induction: Lipoproteins stimulate proinflammatory cytokines (e.g., TNF-α, IL-8) via Toll-like receptor 2 (TLR2) signaling. Lgt-deficient mutants show diminished cytokine production, suggesting Lgt-modified lipoproteins are TLR2 agonists .

Vaccine Development

Recombinant Lgt may serve as a component in attenuated Salmonella vaccines. For example:

Vaccine StrategyOutcomeSource
Live Attenuated StrainsS. choleraesuis mutants with modified Lgt or lipoprotein genes show reduced virulence and induce protective immunity .
Heterologous Antigen DeliveryRecombinant Salmonella expressing Lgt could deliver antigens for multivalent vaccines, though direct evidence is lacking .

Challenges and Future Directions

  • Enzymatic Specificity: Lgt’s substrate range and interaction with lipoprotein signal peptidase (Lsp) require further characterization in S. choleraesuis .

  • Therapeutic Targeting: Lgt’s essential role in Gram-negative bacteria positions it as a potential antibiotic target. Inhibitors of Lgt could disrupt bacterial membrane integrity .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, should you have specific format requirements, kindly indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; SCH_2941; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGALRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from Salmonella choleraesuis catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: sec:SCH_2941

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Lgt in bacterial lipoprotein maturation?

Lgt (Prolipoprotein diacylglyceryl transferase) catalyzes the first and committed step in the post-translational modification pathway of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl (DAG) moiety from phosphatidylglycerol onto the conserved cysteine residue in the lipobox motif of preprolipoproteins via a thioether bond. This modification is essential for proper lipoprotein anchoring to bacterial membranes and occurs after the preprolipoprotein is secreted through the inner membrane via Sec or Tat pathways. The lipid modification serves as a membrane anchor for the mature lipoprotein and is crucial for bacterial cell envelope integrity .

Following Lgt-mediated diacylglyceryl addition, the modified preprolipoprotein undergoes sequential processing by Signal Peptidase II (Lsp), which cleaves the signal peptide, and in Gram-negative bacteria, by Apolipoprotein N-acyltransferase (Lnt), which adds a third acyl chain. The entire pathway ensures proper trafficking and localization of lipoproteins, which serve critical functions in bacterial physiology and virulence .

Why is Lgt considered a potential antimicrobial target?

Lgt represents a promising antimicrobial target for several compelling reasons. First, it is essential for viability in proteobacteria, making it an attractive target for developing narrow-spectrum antibiotics against these pathogens . Second, Lgt is highly conserved across bacterial species but absent in archaea and eukaryotes, offering excellent target specificity . Third, its membrane localization and relative accessibility from the periplasmic side provide practical advantages for drug targeting compared to cytoplasmic enzymes .

Research demonstrates that Lgt depletion or inhibition in pathogenic bacteria leads to significant growth defects and reduced virulence. For example, in uropathogenic Escherichia coli strains, Lgt depletion results in severe growth impairment and compromised pathogenicity . Furthermore, studies with Listeria monocytogenes have shown that deletion of the lgt gene impairs intracellular bacterial growth in various eukaryotic cell lines, highlighting its importance in host-pathogen interactions .

How does the structure of Salmonella choleraesuis Lgt compare to other bacterial Lgt proteins?

The structure of Salmonella choleraesuis Lgt shares significant similarities with other bacterial Lgt proteins, particularly with Escherichia coli Lgt, which has been characterized by X-ray crystallography. Bioinformatic analyses using AlphaFold structural models reveal that Lgt maintains a highly conserved core structure across different bacterial species, with seven transmembrane segments being a common feature .

Comparative analysis shows that structural variability primarily occurs in the arm and head domains of the protein. These regions contain less conserved residues across species and may account for functional differences in substrate specificity or regulatory mechanisms . The periplasmic head domain, in particular, has been demonstrated to be critical for Lgt function through complementation studies, where chimeric proteins with heterologous head domains showed compromised functionality .

What are the optimal conditions for expressing and purifying recombinant Salmonella choleraesuis Lgt?

Successful expression and purification of recombinant Salmonella choleraesuis Lgt requires specialized protocols that address challenges associated with membrane proteins. Based on established methodologies, the following approach is recommended:

Expression System:

  • Host: E. coli BL21(DE3) or C43(DE3) strains (designed for membrane protein expression)

  • Vector: pET-based with a C-terminal His-tag or alternative tag that won't interfere with transmembrane domains

  • Induction: Low IPTG concentration (0.1-0.3 mM) at reduced temperature (16-20°C) for 16-20 hours to minimize inclusion body formation

Purification Protocol:

  • Cell lysis: Mechanical disruption (French press or sonication) in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane extraction: Solubilization with 1-2% mild detergent (DDM, LDAO, or C12E8)

  • Affinity chromatography: IMAC purification with detergent concentration maintained above CMC

  • Optional size exclusion chromatography for higher purity

  • Final storage in 50 mM Tris-based buffer with 50% glycerol at -20°C as indicated for the commercial preparation

Critical Considerations:

  • Maintain detergent concentration above critical micelle concentration throughout purification

  • Include phospholipids (0.1-0.5 mg/mL) during purification to stabilize the protein

  • Avoid repeated freeze-thaw cycles as this compromises functional integrity

What assays can be used to measure Lgt enzymatic activity?

Several complementary approaches can be employed to assess Lgt enzymatic activity:

In Vitro Biochemical Assays:

  • Radiolabeled Phospholipid Incorporation: Using 14C or 3H-labeled phosphatidylglycerol as substrate and measuring transfer to synthetic preprolipoprotein peptides

  • FRET-Based Assays: Employing fluorescently labeled substrate peptides that exhibit altered FRET signal upon diacylglyceryl modification

  • Mass Spectrometry: Detecting mass shift in substrate peptides following diacylglyceryl addition

Cellular Activity Assays:

  • Complementation Testing: Measuring restoration of growth in conditionally lethal Lgt depletion strains, as demonstrated with heterologous Lgt proteins from different species

  • Pulse-Chase Analysis: Monitoring lipoprotein processing kinetics using radioactively labeled amino acids

  • Western Blot Mobility Shift: Detecting altered migration patterns of lipoproteins in the presence/absence of functional Lgt

Phenotypic Assays:

  • Lipoprotein Mislocalization: Analyzing cell fractions for aberrant lipoprotein distribution (e.g., presence in culture supernatant instead of membrane fractions)

  • Cell Morphology Analysis: Microscopic examination for characteristic phenotypes such as filamentation or lysis seen in Lgt-deficient strains

  • Membrane Integrity Tests: Measuring sensitivity to membrane-disrupting agents (polymyxin B, DOC) that typically increases with Lgt dysfunction

How can researchers generate and validate Lgt mutants for structure-function studies?

Creating and validating Lgt mutants requires a systematic approach to ensure reliable structure-function analysis:

Mutant Generation Strategies:

  • Site-Directed Mutagenesis: Target conserved residues identified through sequence alignments. The 16 completely conserved residues across pathogenic species provide excellent starting points

  • Domain Swapping: Create chimeric proteins by exchanging domains (particularly arm and head domains) between Lgt homologs from different species to assess domain-specific functions

  • Conditional Expression Systems: For essential residues, employ arabinose-inducible or tetracycline-regulated expression systems that allow controlled depletion of native Lgt while expressing the mutant variant

Validation Methods:

  • Complementation Analysis: Test mutants' ability to restore growth in Lgt depletion strains (e.g., ΔlgtΔlpp double mutants which can survive without functional Lgt)

  • Microscopic Analysis: Examine cell morphology for characteristic defects such as filamentation and lysis that indicate compromised Lgt function

  • Lipoprotein Localization: Monitor specific lipoproteins (e.g., Lpp) for mislocalization using fractionation and immunoblotting

  • Proteome Analysis: Employ comparative extracellular proteome analyses to identify released lipoproteins, as demonstrated in the Listeria monocytogenes Δlgt model

Experimental Design for Structure-Function Studies:

Mutation TypePurposeValidation MethodExpected Outcome
Conserved catalytic residuesDetermine essential residues for enzymatic activityComplementation assayNo growth rescue
Head domain mutationsAssess role in substrate recognitionExtracellular proteome analysisAltered lipoprotein processing profile
Transmembrane domain mutationsEvaluate membrane integrationMembrane fractionation + Western blotAltered protein localization
Chimeric constructsDefine species-specific differencesCross-species complementationVariable growth restoration based on compatibility

How does Lgt deletion affect bacterial virulence and immunogenicity?

Lgt deletion has profound effects on bacterial virulence and immunogenicity, making it valuable for both pathogenesis studies and vaccine development:

Impact on Virulence:

Deletion of lgt in pathogenic bacteria typically results in attenuated virulence. In Listeria monocytogenes, Δlgt mutants show impaired intracellular growth in various eukaryotic cell lines . This attenuation likely stems from:

  • Compromised cell envelope integrity due to mislocalization of essential lipoproteins

  • Altered host-pathogen interactions as surface-exposed lipoproteins play critical roles in adhesion and immune evasion

  • Disrupted nutrient acquisition systems that often depend on lipoprotein components

  • Increased susceptibility to host defense mechanisms due to membrane perturbations

Immunological Consequences:

Lgt deletion creates a unique immunological profile characterized by:

  • Increased release of lipoproteins into the extracellular environment, effectively creating a "protein shedding" phenotype

  • Enhanced exposure of immunogenic lipoproteins that would normally be anchored to the bacterial surface

  • Modified interaction with host pattern recognition receptors that recognize bacterial lipoproteins

Applications in Vaccine Development:

The immunological properties of Δlgt strains make them promising vaccine candidates:

  • Attenuated virulence provides inherent safety while maintaining immunogenicity

  • Released lipoproteins serve as potent antigens for immune recognition

  • The combination of bacterial attenuation with enhanced antigen presentation creates balanced protective immunity

For example, recombinant attenuated Salmonella Typhimurium expressing Salmonella Choleraesuis O-antigens has shown promise as a bivalent vaccine. When properly attenuated through additional mutations (e.g., crp and cya), these strains induce significant antibody responses against both homologous and heterologous antigens, providing cross-protection against multiple Salmonella serotypes .

What approaches can be used to study the role of Lgt in bacterial membrane homeostasis?

Investigating Lgt's role in membrane homeostasis requires multidisciplinary approaches:

Lipid Composition Analysis:

  • Lipidomics: Mass spectrometry-based profiling of membrane phospholipids in wild-type versus Lgt-depleted conditions to identify compositional changes

  • Radiolabeling Studies: Tracking phospholipid turnover rates using 32P or 14C-labeled precursors

  • Thin-Layer Chromatography: Quantifying relative abundance of phosphatidylglycerol and other phospholipids

Membrane Physical Properties Assessment:

  • Fluorescence Anisotropy: Measuring membrane fluidity changes using DPH or TMA-DPH probes

  • Differential Scanning Calorimetry: Analyzing phase transition temperatures of membrane preparations

  • Atomic Force Microscopy: Visualizing nanoscale membrane organization and rigidity

Protein-Lipid Interaction Studies:

  • Photocrosslinking: Using photoactivatable lipid analogs to identify Lgt-lipid interactions

  • Detergent Resistance Assays: Evaluating membrane domain organization through differential detergent extraction

  • Förster Resonance Energy Transfer (FRET): Measuring proximity between labeled Lgt and specific membrane components

Genetic Interaction Mapping:

  • Synthetic Lethality Screening: Identifying genes that become essential in Lgt-depleted backgrounds, such as demonstrated with YciB and DcrB

  • Suppressor Analysis: Isolating mutations that rescue Lgt depletion phenotypes

  • Transcriptome Analysis: Profiling gene expression changes in response to Lgt depletion to identify compensatory pathways

Research has revealed that Lgt function is linked to broader aspects of membrane homeostasis. For instance, studies with YciB and DcrB inner membrane proteins suggest that altered membrane fluidity may impact Lgt activity. This is supported by observations that Lgt function is compromised at low temperatures, which affect membrane fluidity, and that certain double mutants (e.g., yciB dcrB) show synthetic lethality due to impaired Lgt-mediated lipoprotein modification .

What are common pitfalls in Lgt functional assays and how can they be addressed?

Researchers working with Lgt face several technical challenges that can affect experimental outcomes:

Challenge 1: Membrane Protein Stability

Lgt, as a seven-transmembrane protein, is prone to misfolding and aggregation during handling.

Solutions:

  • Use mild detergents (DDM, LDAO) at concentrations just above CMC

  • Add phospholipids (0.1-0.5 mg/ml) to purification buffers to stabilize native conformation

  • Maintain glycerol (10-50%) in storage buffers to prevent aggregation

  • Avoid repeated freeze-thaw cycles; store as single-use aliquots

  • Consider membrane mimetics (nanodiscs, amphipols) for long-term stability

Challenge 2: Distinguishing Direct vs. Indirect Effects

When studying Lgt depletion or deletion, secondary effects can confound interpretation.

Solutions:

  • Use rapidly inducible depletion systems to capture immediate effects before secondary consequences

  • Employ complementation with catalytically inactive mutants as controls

  • Include parallel experiments with Δlpp backgrounds when studying E. coli, as many phenotypes are mediated by mislocalized Lpp

  • Perform time-course analyses to distinguish primary from secondary effects

  • Combine with specific inhibitors when available to validate genetic results

Challenge 3: Variability in Phenotypic Outcomes

Lgt mutant phenotypes can vary significantly depending on genetic background and growth conditions.

Solutions:

  • Standardize growth conditions (particularly temperature and media composition)

  • Test phenotypes in multiple genetic backgrounds

  • Include appropriate controls for each specific assay

  • Consider the impact of suppressor mutations, which may arise spontaneously

  • Monitor growth kinetics rather than endpoint measurements when possible

Challenge 4: Species-Specific Differences

Findings from one bacterial species may not directly translate to others due to differences in lipoprotein processing pathways.

Solutions:

How can researchers distinguish between essential and non-essential functions of Lgt?

Distinguishing between essential and non-essential Lgt functions requires strategic experimental approaches:

Genetic Suppression Analysis:

The lethality of lgt deletion in proteobacteria can be suppressed by specific secondary mutations, revealing which aspects of Lgt function are truly essential:

  • Lpp Deletion: In E. coli, deleting the abundant lipoprotein Lpp (ΔlgtΔlpp double mutant) rescues lethality, indicating that mislocalized Lpp is a primary cause of toxicity

  • Lpp-Peptidoglycan Linkage Disruption: Removing Lpp's ability to form covalent linkages with peptidoglycan also suppresses lgt deletion toxicity

  • Conditional Essential Genes: Identification of genes that become essential only under Lgt depletion conditions highlights compensatory pathways

Quantitative Phenotypic Analysis:

Measuring different phenotypic outcomes provides insights into function importance:

Temporal Control Strategies:

Using timed depletion or inhibition of Lgt activity helps separate primary from secondary effects:

  • Inducible Expression Systems: Arabinose or tetracycline-regulated promoters controlling lgt expression

  • Degron-Tagged Constructs: Enabling rapid protein degradation upon induction

  • Time-Course Sampling: Analyzing phenotypic progression at multiple time points following Lgt depletion

Domain-Specific Function Analysis:

Targeted mutations can selectively disrupt specific functions while preserving others:

  • Catalytic vs. Structural Roles: Mutations in catalytic residues separate enzymatic from structural functions

  • Domain-Specific Mutations: Targeted changes in arm or head domains can affect specific substrate interactions

  • Separation-of-Function Mutants: Identifying variants that maintain viability but show defects in specific pathways

Research has demonstrated that in E. coli, the essential nature of Lgt stems primarily from preventing toxic mislocalization of Lpp to the inner membrane, where it forms aberrant linkages to peptidoglycan . This finding suggests that the processing of specific lipoproteins, rather than global lipoprotein maturation, constitutes the essential function of Lgt in some organisms.

What are promising strategies for developing Lgt inhibitors as potential antibiotics?

The essential nature of Lgt in proteobacteria makes it an attractive target for novel antibiotics. Several promising approaches are being explored:

Structure-Based Drug Design:

With the resolution of E. coli Lgt structure and availability of AlphaFold models for other species, rational design approaches can target:

  • Active Site Inhibitors: Compounds that compete with phosphatidylglycerol binding

  • Allosteric Modulators: Molecules that bind regulatory sites to induce conformational changes

  • Interfacial Inhibitors: Agents that disrupt Lgt-substrate interactions at the membrane interface

High-Throughput Screening Approaches:

Functional assays amenable to high-throughput formats include:

  • Fluorescence-Based Activity Assays: Using fluorogenic peptide substrates

  • Cell-Based Reporter Systems: Employing conditional lethality or stress response readouts

  • Fragment-Based Screening: Identifying chemical scaffolds with affinity for Lgt binding pockets

Species-Selective Targeting:

The variability in arm and head domains offers opportunities for selective inhibition:

  • Exploiting Structural Differences: Targeting non-conserved regions unique to specific pathogens

  • Differential Binding Analysis: Screening compounds against Lgt panels from different species

  • Synergistic Combinations: Pairing Lgt inhibitors with other agents that stress the cell envelope

Pharmacophore Development:

Analysis of essential residues and structural features suggests critical pharmacophore elements:

  • Lipid-Mimetic Groups: To compete with phosphatidylglycerol binding

  • Peptide-Mimetic Motifs: To interfere with lipobox recognition

  • Membrane-Associating Elements: To facilitate localization to Lgt's native environment

The development path should consider that inhibitors must penetrate the outer membrane of Gram-negative bacteria to reach their target, requiring balanced physicochemical properties. Additionally, proof-of-concept studies demonstrating the antibacterial effects of Lgt depletion in uropathogenic E. coli provide validation for this approach .

How might Lgt manipulation be leveraged for vaccine development?

Lgt engineering offers innovative approaches for vaccine development:

Attenuated Live Vaccine Platforms:

Controlled modulation of Lgt activity can create balanced attenuation:

  • Regulated Expression: Using inducible promoters to control Lgt levels in vivo

  • Partial-Function Mutants: Engineering Lgt variants with reduced but not abolished activity

  • Host-Responsive Attenuation: Designing systems where Lgt function decreases specifically in host environments

Enhanced Antigen Presentation:

Lgt manipulation can improve immune responses:

  • Lipoprotein Release: Partial Lgt inhibition increases release of immunogenic lipoproteins

  • Surface Display Systems: Engineering lipoproteins as carriers for heterologous antigens

  • Adjuvant Effects: Leveraging the intrinsic immunostimulatory properties of bacterial lipoproteins

Multivalent Vaccine Approaches:

Studies have demonstrated successful creation of multivalent vaccines using recombinant attenuated Salmonella:

  • Heterologous Antigen Expression: Salmonella Typhimurium expressing Salmonella Choleraesuis O-antigens provided both homologous protection and 83% cross-protection

  • Combined Attenuation Strategies: Incorporating crp and cya mutations alongside engineered lipoprotein modifications enhances safety while maintaining immunogenicity

  • Balanced Immune Responses: These approaches elicit both humoral (IgG, IgA) and cell-mediated immunity

Practical Implementation:

The development of recombinant attenuated Salmonella vaccines has shown that:

  • Multiple immunizations (typically two doses) are required for optimal protection

  • Serum IgG and mucosal IgA responses develop with different kinetics

  • Cross-protection against heterologous challenges is achievable but varies by strain design

  • Specific immune responses can be measured by ELISA against homologous or heterologous LPS

This approach has particular promise for developing countries where Salmonella infections remain a significant health burden, offering economical production and potential oral administration routes.

How does Lgt function interact with bacterial stress response systems?

Recent research reveals complex interactions between Lgt function and bacterial stress responses:

Envelope Stress Response Activation:

Lgt dysfunction triggers specific stress response pathways:

  • Cpx System Activation: The Cpx two-component system responds to misfolded periplasmic and membrane proteins, becoming upregulated during Lgt depletion

  • Rcs Signaling: The Rcs phosphorelay system, which responds to outer membrane and peptidoglycan stress, is triggered by Lgt dysfunction

  • σE Response: Increased activity of the extracytoplasmic stress sigma factor may occur due to envelope perturbations

Compensatory Mechanisms:

Bacteria employ several strategies to mitigate Lgt deficiency effects:

  • Membrane Vesiculation: Increased production of outer membrane vesicles serves to remove mislocalized lipoproteins and toxic products

  • Altered Lipid Composition: Changes in phospholipid synthesis pathways may compensate for membrane perturbations

  • Transcriptional Reprogramming: Global changes in gene expression patterns to stabilize the cell envelope

Cross-Talk with Other Post-Translational Systems:

Lgt function intersects with other bacterial processes:

  • Secretion System Regulation: Altered lipoprotein processing affects assembly and function of secretion machineries

  • Cell Division Coordination: Lgt depletion can lead to filamentation, suggesting links to division machinery

  • Peptidoglycan Remodeling: Mislocalized Lpp forms aberrant crosslinks with peptidoglycan, affecting cell wall integrity

Understanding these interactions provides insight into bacterial adaptation strategies and may reveal additional targets for antimicrobial intervention or vaccine development.

What is known about the temporal and spatial regulation of Lgt activity in bacterial cells?

The dynamics of Lgt activity regulation remain an emerging area of research:

Temporal Regulation:

Evidence suggests Lgt activity may be regulated in response to environmental conditions:

  • Growth Phase-Dependent Expression: Changes in lgt expression levels during different growth phases

  • Post-Translational Modification: Potential regulation through phosphorylation or other modifications

  • Substrate Availability: Fluctuations in phosphatidylglycerol levels may naturally modulate activity

Spatial Organization:

As a membrane-embedded enzyme, Lgt shows specific localization patterns:

  • Membrane Domain Association: Potential preferential localization to specific membrane microdomains

  • Co-localization with Substrate Processing: Possible proximity to Sec/Tat translocons for efficient substrate processing

  • Dynamic Redistribution: Movement within the membrane in response to environmental changes

Environmental Responsiveness:

Lgt function appears sensitive to environmental conditions:

  • Temperature Dependence: Low-temperature growth exacerbates phenotypes in some Lgt-compromised strains, suggesting temperature-sensitive regulation

  • Membrane Fluidity Effects: Changes in membrane physical properties impact Lgt function, potentially serving as a regulatory mechanism

  • Nutrient Availability: Changes in phospholipid composition due to nutrient limitation may affect substrate availability

Further research into these regulatory aspects will provide deeper understanding of how bacteria coordinate lipoprotein processing with other cellular processes and environmental adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.