Recombinant Salmonella choleraesuis Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SCH_0659; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: sec:SCH_0659

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella choleraesuis Protein CrcB homolog and what is its primary function?

Recombinant Salmonella choleraesuis Protein CrcB homolog (crcB) is a membrane protein that functions primarily as a fluoride ion transporter. While crcB genes were previously implicated in chromosome condensation and camphor resistance, more recent research has established their critical role in reducing cellular fluoride concentrations, thereby mitigating fluoride toxicity in bacterial cells. Studies with Escherichia coli strains carrying genetic knockouts of crcB demonstrate that these mutants cannot grow at 50 mM fluoride and exhibit high reporter gene expression even at low fluoride concentrations (0.2 mM), confirming the protein's essential role in fluoride homeostasis . The protein is part of a superfamily predominantly composed of transporters, with the specific function of exporting fluoride ions from the cellular interior to reduce their toxic effects .

How is CrcB expression regulated in bacterial cells?

CrcB expression is primarily regulated by fluoride-responsive riboswitches, which are metabolite-binding RNA structures located in bacterial messenger RNAs . These riboswitches act as genetic switches that sense fluoride ions and modulate gene expression accordingly. When intracellular fluoride concentrations increase, the riboswitch undergoes a conformational change that promotes the expression of crcB genes, resulting in increased production of CrcB proteins to enhance fluoride export from the cell. Experimental data show that reporter gene expression driven by fluoride riboswitches increases in proportion to fluoride concentration in culture media until the anion concentration becomes toxic to cells . This regulatory mechanism represents a sophisticated bacterial adaptation to survive in environments containing toxic levels of fluoride.

What expression systems are available for producing recombinant CrcB protein?

Multiple expression systems have been developed for the production of recombinant Salmonella choleraesuis Protein CrcB homolog. Based on the search results, researchers can choose from the following expression systems, each with specific advantages for different experimental applications:

Expression SystemProduct CodeSourceSpecial Features
E. coliCSB-EP710318SBF1E. coliStandard bacterial expression
E. coli with BiotinCSB-EP710318SBF1-BE. coliAvi-tag Biotinylated by BirA technology
YeastCSB-YP710318SBF1YeastEukaryotic processing capabilities
BaculovirusCSB-BP710318SBF1BaculovirusEnhanced expression of membrane proteins
Mammalian cellCSB-MP710318SBF1Mammalian cellNative-like post-translational modifications

The selection of an appropriate expression system should be based on experimental requirements, with E. coli systems typically providing high yields, while eukaryotic systems may offer advantages for proper folding and post-translational modifications of membrane proteins . For interaction studies, the biotinylated version offers the advantage of controlled immobilization on streptavidin surfaces.

How can I design effective knockout experiments to study CrcB function?

Designing effective knockout experiments for studying CrcB function requires a systematic approach based on homologous recombination methods. Based on the recombineering techniques described in the search results, the following methodology is recommended:

  • Generation of the linear targeting substrate: Amplify the aminoglycoside 3'-phosphotransferase (kan) gene with 50 bp homology arms of crcB on each side from a plasmid like pKD4 . High-fidelity Taq DNA polymerase with proofreading ability should be used for generating this PCR product.

  • Provision and induction of λ Red recombination genes: Introduce the λ Red recombination system into your bacterial strain to facilitate homologous recombination.

  • Preparation of electrocompetent cells: Prepare the target strain carrying the λ Red system and electroporate the linear targeting substrate DNA.

  • Selection and confirmation: Select transformants on kanamycin-containing media and confirm the knockout using PCR with primers flanking the crcB gene region.

  • Phenotypic characterization: Compare the growth of wild-type and knockout strains at various fluoride concentrations (0-100 mM) in both solid and liquid media, measuring growth curves over time .

  • Fluoride sensitivity assay: Assess reporter gene expression using a fluoride riboswitch-controlled reporter system in both wild-type and knockout strains at different fluoride concentrations .

This methodology has been successfully applied to demonstrate that crcB knockout strains exhibit increased sensitivity to fluoride, confirming the protein's role in fluoride toxicity resistance .

What techniques are most effective for assessing fluoride transport activity of CrcB proteins?

Several complementary techniques can be employed to assess the fluoride transport activity of CrcB proteins with high precision:

  • Growth assays with varying fluoride concentrations: Compare growth curves of wild-type and crcB knockout strains at different fluoride concentrations (0.2-100 mM). The shift in growth inhibition patterns correlates with CrcB's fluoride transport capability .

  • Fluoride-sensitive riboswitch reporter systems: Utilize fluoride riboswitches controlling reporter gene expression to measure intracellular fluoride levels indirectly. Higher reporter activity indicates increased intracellular fluoride, suggesting compromised transport .

  • Direct measurement of fluoride uptake/export: Use fluoride-specific electrodes or fluorescent probes to measure the rate of fluoride transport across membranes in proteoliposomes containing purified CrcB protein.

  • Isotopic flux assays: Employ radioactive fluoride isotopes to track transport kinetics in controlled membrane systems.

  • Normalized fluoride concentration measurements: Calculate fluoride formation or transport per cell by normalizing fluoride concentration data to cell growth (measured by 16S rRNA gene copies/mL), as demonstrated in Acetobacterium bakii studies .

Research has shown that CrcB knockout cells exhibit reporter gene expression at lower fluoride concentrations compared to wild-type cells, with a direct correlation between growth inhibition patterns and reporter gene expression . This correlation provides strong evidence for CrcB's role in fluoride export.

How do CrcB proteins across different bacterial and archaeal species compare?

CrcB proteins show remarkable conservation across diverse prokaryotic lineages, suggesting their fundamental importance in fluoride resistance. Comparative genomic analyses reveal:

  • Widespread distribution: CrcB genes associated with fluoride riboswitches are distributed broadly among bacteria and archaea, indicating the evolutionary significance of fluoride toxicity resistance mechanisms .

  • Sequence diversity: Despite functional similarity, CrcB proteins vary greatly in amino acid sequence across species, suggesting that the core functionality of fluoride transport has been preserved despite sequence divergence .

  • Operon organization: Different bacterial species show variations in the organization of the crcB operon. For example, in Acetobacterium species, the operon may contain transcriptional fluoride riboswitches followed by crcB1 and crcB2 genes, with variations across species. Acetobacterium woodii lacks identified fluoride riboswitches, while in A. fimetarium, crcB2 is truncated .

  • Functional equivalence: In some cases, such as in Streptococcus mutans (a causative agent of dental caries), CrcB proteins are replaced by EriC F proteins at the same genomic location where other Streptococcus species encode CrcB proteins, suggesting functional equivalence between these distinct protein families .

  • Copy number variation: Most species encode at most 2 fluoride riboswitches, but some bacteria contain multiple copies, potentially reflecting adaptation to environments with higher fluoride exposure .

These evolutionary patterns underscore the importance of fluoride toxicity resistance across diverse microbial lineages and suggest that similar mechanisms have evolved independently in different phylogenetic groups.

What is the relationship between CrcB expression and fluoride tolerance in different organisms?

Research demonstrates a direct correlation between CrcB expression levels and fluoride tolerance across various organisms:

  • Knockout studies: E. coli strains with crcB gene knockouts show dramatically reduced tolerance to fluoride, unable to grow at 50 mM fluoride compared to wild-type strains .

  • Dose-response relationship: Reporter gene expression controlled by fluoride riboswitches increases proportionally with fluoride concentration in growth media until reaching toxic levels, indicating a graded response system .

  • Species-specific tolerance: Different bacterial species show varying levels of fluoride tolerance, potentially related to the efficiency of their CrcB homologs or the presence of multiple copies of fluoride resistance genes.

  • Growth curve analysis: Comparison of growth curves between wild-type and crcB knockout cells at various fluoride concentrations shows a clear shift in the concentration at which growth inhibition occurs, directly linking CrcB function to fluoride tolerance .

  • Environmental adaptations: Organisms from fluoride-rich environments may possess enhanced CrcB expression systems or more efficient CrcB variants, representing evolutionary adaptations to their specific niches.

These patterns suggest that CrcB expression levels serve as a critical determinant of an organism's ability to survive in environments containing fluoride, with implications for understanding microbial ecology in both natural and clinical settings.

How does CrcB function within broader cellular detoxification pathways?

CrcB functions as part of an integrated cellular response to fluoride toxicity, interacting with multiple detoxification pathways:

  • Riboswitch-mediated regulation: Fluoride riboswitches sense elevated fluoride levels and upregulate not only CrcB but potentially other genes involved in fluoride resistance, creating a coordinated response .

  • Membrane transport systems: CrcB likely works in concert with other membrane transporters to maintain ion homeostasis, particularly when cells are exposed to multiple toxic compounds simultaneously.

  • Metabolic adaptations: Cells exposed to fluoride may undergo broader metabolic changes to mitigate toxicity effects, as suggested by transcriptional and translational alterations observed during microbial defluorination processes .

  • Species-specific pathways: In Acetobacterium bakii, studies show interactions between CrcB expression and caffeate metabolism during exposure to fluorinated compounds, suggesting complex metabolic networks involved in fluoride detoxification .

  • Cross-species detoxification mechanisms: The presence of CrcB homologs in diverse organisms, including eukaryotic lineages such as fungi and plants, suggests conserved detoxification pathways that have evolved across domains of life .

Understanding these integrated pathways offers insights into bacterial survival mechanisms and potential targets for antimicrobial development, particularly against fluoride-resistant pathogens like Streptococcus mutans.

How can recombinant CrcB be utilized in environmental bioremediation research?

Recombinant CrcB proteins hold significant potential for environmental bioremediation applications, particularly for fluorinated pollutants:

  • Fluorinated compound degradation: Studies with Acetobacterium bakii demonstrate that organisms with functional CrcB proteins can participate in the biotransformation and defluorination of perfluorinated compounds, suggesting applications for environmental cleanup of persistent organic pollutants .

  • Engineered bioremediation systems: Bacteria expressing optimized CrcB variants could potentially be employed in bioreactors or environmental release systems to reduce fluoride levels in contaminated water or soil.

  • Community-based approaches: Environmental microbial communities from different sites show varying capabilities for biodefluorination of perfluorinated compounds, suggesting that CrcB-expressing bacteria could be selected or enhanced for site-specific bioremediation strategies .

  • Monitoring tools: Fluoride riboswitch-based reporter systems linked to CrcB expression could serve as biosensors for fluoride contamination in environmental samples, providing real-time monitoring capabilities.

  • Synergistic systems: Research indicates that combining CrcB-expressing organisms with specific metabolic substrates (like caffeate) may enhance defluorination capabilities, pointing toward optimized bioremediation formulations .

The documented ability of CrcB-containing bacteria to transform and defluorinate compounds like PFMeUPA (perfluorinated compounds) demonstrates the practical potential of these systems for addressing challenging environmental contamination issues .

What are the recommended storage and handling conditions for recombinant CrcB protein?

Proper storage and handling of recombinant CrcB protein are essential for maintaining its structural integrity and functional activity:

  • Storage temperature: Store lyophilized protein at -20°C, and for extended storage, conserve at -20°C or -80°C .

  • Reconstitution: Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage buffer: For optimal stability, add glycerol to 5-50% final concentration and prepare aliquots for long-term storage at -20°C/-80°C .

  • Working aliquots: Store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

  • Purity considerations: Commercially available recombinant CrcB protein typically has >85% purity as determined by SDS-PAGE, which is sufficient for most research applications .

These handling guidelines are particularly important for membrane proteins like CrcB, which are often less stable than soluble proteins and require careful management to preserve their native conformation and functional properties.

What future research directions might advance our understanding of CrcB function?

Several promising research directions could significantly enhance our understanding of CrcB function and applications:

  • High-resolution structural studies: Determination of CrcB crystal structure or cryo-EM analysis would provide critical insights into the molecular mechanism of fluoride transport, potentially enabling rational design of modified proteins with enhanced properties.

  • Single-molecule transport studies: Application of advanced biophysical techniques to study fluoride transport at the single-molecule level could reveal transport kinetics and gating mechanisms of CrcB channels.

  • Synthetic biology applications: Development of engineered CrcB variants with modified specificity or enhanced transport rates could enable novel biotechnological applications in biosensing and bioremediation.

  • Clinical relevance exploration: Investigation of CrcB's potential role in fluoride resistance of oral pathogens like Streptococcus mutans could inform new approaches to dental caries prevention or treatment .

  • Comparative genomics expansion: Broader analysis of CrcB distribution across diverse organisms, including uncultivated microbes from extreme environments, might reveal novel fluoride resistance mechanisms or adaptations.

  • Interactome mapping: Identification of proteins that interact with CrcB could provide insights into larger detoxification networks and potential synergistic targets for antimicrobial development.

These research directions represent significant opportunities to expand our fundamental understanding of cellular detoxification mechanisms while potentially yielding practical applications in biotechnology, medicine, and environmental science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.