Recombinant Salmonella choleraesuis Protein MgtC (mgtC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella choleraesuis Protein MgtC (mgtC)

Recombinant Salmonella choleraesuis Protein MgtC (mgtC) is a bacterial virulence factor expressed in E. coli for research purposes. This protein is critical for Salmonella’s survival within host macrophages and growth in magnesium-limited environments . The recombinant form is engineered with a His-tag to facilitate purification and functional studies .

2.2. Biological Roles

MgtC performs dual functions:

  1. ATP Regulation: Inhibits the F₁F₀ ATP synthase, reducing cytoplasmic ATP levels and stabilizing cytoplasmic pH .

  2. Pathogen Adaptation:

    • pH Homeostasis: Maintains near-neutral pH in acidic macrophage environments .

    • PhoP Stabilization: Prevents degradation of PhoP, a master regulator of virulence genes .

    • Cellulose Repression: Lowers cyclic diguanylate (c-di-GMP), inhibiting cellulose biosynthesis to avoid biofilm formation during infection .

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, leveraging codon optimization for high yield. Key steps include:

  1. Cloning: Insertion of the mgtC gene into a plasmid with a His-tag.

  2. Induction: IPTG-mediated expression under optimized conditions.

  3. Purification: Nickel-affinity chromatography to isolate His-tagged MgtC .

Regulatory Mechanisms

MgtC activity is tightly controlled by:

RegulatorMechanism
CigRBinds MgtC, preventing ATP synthase inhibition until MgtC surpasses CigR levels .
MgtRPeptide encoded by the mgtCB operon; promotes MgtC degradation via FtsH protease .
AmgRAnti-sense RNA complementary to mgtC mRNA; reduces translation .

5.1. Virulence Studies

MgtC’s role in:

  • Intracellular Survival: Required for replication within macrophages .

  • Magnesium Depletion: Enables growth in low Mg²⁺ environments .

  • Antibiotic Tolerance: Reduced ATP levels may enhance persistence under stress .

5.2. Functional Assays

Assay TypePurpose
ATP MeasurementQuantify inhibition of F₁F₀ ATP synthase .
Protein InteractionStudy MgtC-CigR/MgtR binding via co-IP or bacterial two-hybrid assays .
c-di-GMP AnalysisLink MgtC activity to cellulose repression .

6.1. Dual Roles in Host and Non-Host Environments

MgtC homologs from Yersinia pestis fully complement Salmonella ΔmgtC in macrophages, while Pseudomonas aeruginosa homologs only restore low Mg²⁺ growth . This highlights MgtC’s conserved and pathogen-specific functions.

6.2. mRNA Leader Regulation

The mgtCBR mRNA leader contains upstream ORFs (mgtM, mgtP) that modulate mgtC expression. Mutations in mgtM increase MgtC production, mimicking ΔLD (leader deletion) strains .

6.3. CigR Threshold Dynamics

CigR protein levels exceed MgtC early during infection, delaying virulence activation until MgtC accumulates . This threshold mechanism prevents premature ATP depletion in transient environments.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with that tag.
Synonyms
mgtC; SCH_3685; Protein MgtC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
mgtC
Target Protein Sequence
MEERMLMFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPD SPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATI IILCANILLREAAQRINQLPVSAEGEKRYILKVTCNKEDESEVRQWLLNIVKEAAICLQG LGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ
Uniprot No.

Target Background

Function
MgtC is a virulence factor essential for Salmonella choleraesuis growth in low Mg(2+) environments and for survival within macrophages. It may play a role in regulating membrane potential by activating Na(+)/K(+)-ATPase.
Database Links

KEGG: sec:SCH_3685

Protein Families
MgtC/SapB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.