Recombinant Salmonella choleraesuis Protein psiE (psiE)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The psiE protein is produced in E. coli via recombinant DNA technology. Key steps include:

  • Cloning: The psiE gene (locus tag: SCH_4105) is inserted into a prokaryotic expression vector.

  • Induction: Protein expression is induced under optimized conditions.

  • Purification: Affinity chromatography using the His-tag ensures high purity (>90%).

  • Quality Control: Validated by SDS-PAGE and mass spectrometry .

Stability testing confirms the protein retains integrity for >1 year at -80°C when stored lyophilized. Repeated freeze-thaw cycles are discouraged .

Research Applications

Recombinant psiE is primarily used for:

  • Antibody Production: As an immunogen to generate anti-psiE polyclonal or monoclonal antibodies.

  • Diagnostic Assays: Potential inclusion in ELISA or Western blot kits for Salmonella detection (though validation studies are unpublished).

  • Structural Studies: Analysis of its role in bacterial physiology or pathogenicity.

Limitations and Future Directions

  • Functional Data Gap: The protein’s biological role in S. choleraesuis remains uncharacterized.

  • Immunogenicity: Unlike Salmonella vaccine vectors expressing antigens like FedF or Stx2eA , psiE lacks evidence of eliciting protective immunity.

  • Comparative Studies: Cross-species analysis with E. coli psiE may clarify evolutionary conserved functions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
psiE; SCH_4105; Protein PsiE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
psiE
Target Protein Sequence
MMPLSRSRLEFIATILQNVLNLGLLTLGLILVVFLGKETVHLADALFAPEQASKYELVEG LVIYFLYFEFIALIVKYFKSGLHFPLRYFVYIGITAIVRLIIVDHKTPMDVLLYSAAILL LVITLWLCNSNRLRRE
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_4105

Protein Families
PsiE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the principle behind using recombinant attenuated Salmonella Choleraesuis as a vaccine vector?

Recombinant attenuated Salmonella Choleraesuis functions as a vaccine vector by delivering heterologous antigens to the immune system. This approach leverages several biological advantages: the vector mimics natural infections, induces robust mucosal immunity (critical for respiratory pathogens), and simultaneously stimulates humoral and cellular immune responses. The system operates by incorporating genes encoding target antigens from pathogens of interest into attenuated Salmonella strains, which then express these foreign antigens when administered to the host. This technology is particularly valuable for developing vaccines against pathogens that require mucosal protection, as the Salmonella vector can effectively deliver antigens to mucosal surfaces .

What are the key components of the regulated delayed attenuation system in vectors like rSC0016?

The regulated delayed attenuation system in vectors such as rSC0016 represents a sophisticated genetic engineering approach that balances safety and immunogenicity. This system initially allows the vector to establish itself in host tissues by maintaining near wild-type phenotype upon administration, followed by programmed attenuation to ensure safety. The system incorporates several genetic modifications:

  • Regulated delayed attenuation mechanisms that control virulence factor expression

  • Regulated delayed antigen synthesis systems that optimize foreign antigen expression

  • Specific gene deletions (such as sopB) that reduce inflammatory responses in intestinal tissues

These components work together to create a vector that efficiently colonizes lymphoid tissues while maintaining an appropriate safety profile. For example, the rSC0016 vector incorporates these systems to reduce intestinal inflammatory responses caused by the Salmonella vector itself .

How does the balanced lethal system using Asd contribute to plasmid stability?

The balanced lethal system utilizing the Asd gene represents a critical advancement in maintaining plasmid stability without antibiotic selection pressure. This system works through complementation of an essential metabolic function:

  • The chromosome of the attenuated Salmonella vector carries a deletion in the asd gene, which encodes aspartate-semialdehyde dehydrogenase, an enzyme essential for diaminopimelic acid (DAP) synthesis

  • The expression plasmid (e.g., pYA3493) contains a functional asd gene

  • Since DAP is required for bacterial cell wall synthesis, only bacteria retaining the plasmid can survive

This creates a powerful selective pressure for plasmid maintenance without antibiotics. In experimental validation, plasmids constructed with this system demonstrated remarkable stability, with consistent retention for over 50 passages in the rSC0016 strain as confirmed by enzyme digestion analysis . This approach is particularly valuable for vaccine development as it eliminates the need for antibiotic resistance markers that would be inappropriate in clinical applications.

What methodological approaches should researchers consider when designing expression systems for heterologous antigens?

Researchers should implement the following methodological considerations when designing expression systems for heterologous antigens in Salmonella vectors:

  • Secretion signal selection: Incorporate appropriate secretion signals, such as the β-lactamase type II secretion signal sequence, to facilitate antigen export to the bacterial surface or extracellular environment. This improves antigen presentation to the immune system .

  • Codon optimization: Adapt the coding sequence to the preferred codon usage of Salmonella to maximize expression efficiency.

  • Promoter selection: Choose promoters that provide appropriate timing and level of antigen expression. Regulated promoters that activate after colonization can prevent metabolic burden during the initial infection stage.

  • Plasmid stability assessment: Test construct stability through serial passage experiments, with restriction enzyme digestion verification at regular intervals (e.g., passages 10, 20, 30, 40, and 50) .

  • Expression verification: Confirm protein expression using immunoblotting techniques with specific antibodies against the target antigen.

The search results demonstrate successful implementation of these approaches with the PlpE antigen from Pasteurella multocida, where Western blot analysis confirmed a 40 kDa band representing the expected size of the recombinant protein in rSC0016(pS-PlpE) but not in control strains .

How can researchers effectively evaluate immune responses to recombinant Salmonella vector vaccines?

A comprehensive immune response evaluation protocol should include assessment of multiple arms of immunity:

  • Mucosal immunity assessment:

    • Measure secretory IgA levels in mucosal secretions (bronchial, intestinal)

    • Evaluate mucosal lymphocyte populations and their antigen-specific responses

  • Humoral immunity analysis:

    • Quantify serum antibody levels (total IgG)

    • Determine antibody subclass distribution (IgG1, IgG2a) to characterize immune polarization

  • Cellular immunity characterization:

    • Measure cytokine profiles (IFN-γ, IL-2, IL-4) from stimulated splenocytes

    • Assess T-cell proliferation in response to antigen stimulation

    • Evaluate CD4+ and CD8+ T-cell responses

  • Protection metrics:

    • Survival rates after challenge

    • Pathogen burden in relevant tissues

    • Histopathological assessment of target organs

    • Clinical scoring systems for disease severity

Research has shown that recombinant Salmonella Choleraesuis vectors expressing heterologous antigens can induce strong mucosal immunity, mixed Th1/Th2 responses, and significant protection against challenge. For instance, mice immunized with rSC0016(pS-PlpE) showed 80% survival against lethal challenge with wild-type Pasteurella multocida, compared to 60% in the inactivated vaccine group .

What are the critical differences in immune responses between recombinant live vector vaccines and inactivated vaccines?

The immunological distinctions between recombinant live vector vaccines and inactivated vaccines involve multiple parameters:

Immune ParameterRecombinant Live Vector VaccinesInactivated Vaccines
Mucosal ImmunityStrong induction of secretory IgALimited mucosal responses
Route of AdministrationEffective via oral/mucosal routesTypically require injection
T-cell PolarizationMixed Th1/Th2 with stronger Th1 componentPredominantly Th2-biased
Cytokine ProfileHigher IFN-γ productionLower IFN-γ, higher IL-4
Memory ResponseMore robust and longer-lastingMay require more frequent boosting
Cross-ProtectionOften broader protectionUsually more strain-specific

Research demonstrates that recombinant Salmonella vectors like rSC0016(pS-PlpE) induce superior mucosal immunity compared to inactivated vaccines. Additionally, they generate potent mixed Th1/Th2 cellular immune responses, as evidenced by the production of both IgG1 and IgG2a isotypes and elevated levels of IFN-γ and IL-4 . In challenge studies, rSC0016(pS-PlpE) provided 80% protection against lethal challenge, exceeding the 60% protection offered by the inactivated vaccine approach .

What strategies can address growth impairment issues when expressing heterologous antigens?

Expression of foreign antigens can impose metabolic burdens on Salmonella vectors, potentially impacting growth kinetics and colonization efficiency. Researchers should consider the following strategies:

  • Regulated expression systems: Implement promoters that activate only after successful colonization to minimize metabolic burden during the initial growth phase.

  • Optimize antigen coding sequences: Modify coding sequences to minimize rare codons or secondary structures that might impede efficient translation.

  • Secretion approach selection: Balance between cytoplasmic expression, periplasmic accumulation, or secretion based on the specific antigen properties.

  • Growth monitoring protocols: Establish comprehensive growth curve analysis comparing vector strains with and without antigen expression.

Growth curve analysis of rSC0016(pS-PlpE) revealed somewhat slower growth between 6-8 hours compared to the empty vector strain rSC0016(pYA3493), indicating that foreign antigen expression may influence growth capacity. This highlights the importance of careful characterization of vector growth kinetics when designing recombinant vaccine strains .

How should researchers approach challenge model selection for evaluating vaccine efficacy?

Challenge model selection requires careful consideration of multiple factors:

  • Species selection:

    • Target species when feasible (most relevant)

    • Laboratory animal models with established correlates to target species

    • Awareness of limitations in extrapolating results (e.g., mouse to pig)

  • Challenge route optimization:

    • Select routes that mimic natural infection

    • Consider intraperitoneal, intranasal, or aerosol challenge depending on the pathogen

  • Challenge dose determination:

    • Perform preliminary LD50 studies

    • Select dose that produces consistent disease in controls while allowing detection of protection

  • Comprehensive evaluation parameters:

    • Survival/mortality (primary endpoint)

    • Clinical scoring systems

    • Pathogen burden in relevant tissues

    • Histopathological evaluation

    • Immunological correlates of protection

Importantly, researchers must acknowledge the limitations of their models. As noted in the literature, "it is crucial to note that the outcomes observed in mice cannot be extrapolated to pigs," emphasizing the need for subsequent validation in target species .

What molecular techniques are most effective for confirming successful construction of recombinant Salmonella vectors?

A systematic verification approach for recombinant Salmonella vectors includes:

  • PCR amplification: Using primers that flank the insertion site to confirm successful gene incorporation

  • Restriction enzyme digestion: Using enzymes that cut at the insertion boundaries (e.g., EcoRI and SalI for the pS-PlpE construct) to verify correct fragment size

  • DNA sequencing: Confirming the exact sequence of the inserted gene and junctions

  • Protein expression verification: Western blotting using specific antibodies against the target antigen

  • Plasmid stability assessment: Serial passage followed by plasmid extraction and restriction digestion at defined intervals

  • Phenotypic confirmation: Growth curve analysis to evaluate impact of recombinant construction

  • Functional assays: Testing biological activity of expressed proteins when applicable

In the construction of rSC0016(pS-PlpE), researchers successfully implemented this comprehensive approach, confirming the construct by PCR amplification, EcoRI and SalI digestion, DNA sequencing, and Western blot analysis showing the expected 40 kDa protein band .

What advances might improve the efficacy of Salmonella vector delivery systems?

Several promising research directions could enhance Salmonella vector efficacy:

  • Enhanced antigen presentation systems: Developing fusion proteins with immune-stimulating molecules or targeting antigens to specific cellular compartments.

  • Microbiome interaction engineering: Designing vectors that interact optimally with the gut microbiome to enhance colonization and immune responses.

  • Combinatorial antigen delivery: Creating vectors expressing multiple protective antigens from a pathogen or antigens from different pathogens for multivalent protection.

  • Tissue-specific colonization: Modifying vectors to preferentially colonize specific lymphoid tissues relevant to particular pathogens.

  • CRISPR-Cas based modifications: Implementing precise genetic modifications to fine-tune attenuation and antigen expression.

Current research demonstrates the potential of these approaches, with recombinant Salmonella vectors delivering antigens like PlpE, P42, and P97 showing significant protection in challenge models. For example, rSC0016(pS-PlpE) provided 80% protection against Pasteurella multocida challenge, indicating the strong potential of this platform for future vaccine development .

How might cross-serotype protection be enhanced in Salmonella vector-based vaccines?

Developing vaccines that protect against multiple serotypes represents a significant challenge in vaccine design. Several approaches show promise:

  • Conserved antigen targeting: Identify and express highly conserved antigens present across multiple serotypes. For example, PlpE protein is present in all Pasteurella multocida serotypes with sequence identity over 90%, making it an ideal candidate for cross-serotype protection .

  • Epitope-based approaches: Design synthetic antigens containing protective epitopes from multiple serotypes.

  • Adjuvant optimization: Explore adjuvant properties of Salmonella vectors that can enhance breadth of immune responses.

  • Mixed antigen expression: Develop vectors expressing a cocktail of serotype-specific antigens.

  • Prime-boost strategies: Combine Salmonella vector priming with alternative delivery platforms for boosting.

The literature suggests that attenuated Salmonella Choleraesuis may represent a valuable platform for developing vaccines against multiple serotypes, as demonstrated with Pasteurella multocida infections .

What biosafety considerations should researchers address when working with recombinant Salmonella vectors?

Working with recombinant Salmonella vectors requires stringent biosafety practices:

  • Containment level determination: Typically Biosafety Level 2 for attenuated strains, with specific risk assessment for each construct.

  • Verification of attenuation: Comprehensive phenotypic testing to confirm attenuation before reducing containment levels.

  • Environmental considerations: Protocols for waste handling and decontamination to prevent environmental release.

  • Monitoring for reversion: Regular testing to ensure attenuation stability over multiple passages.

  • Personnel training: Specialized training for handling live attenuated bacterial vectors.

  • Documentation requirements: Detailed record-keeping of strain construction and validation.

While the search results don't explicitly discuss biosafety procedures, the detailed characterization of attenuation systems like those in rSC0016, including the regulated delayed attenuation system and sopB deletion to reduce inflammatory responses, demonstrates the importance of these considerations in vector development .

What are the key methodological differences between mouse models and target species applications?

Understanding the limitations of mouse models is critical when developing vaccines intended for other species:

  • Anatomical and physiological differences: Mouse intestinal and respiratory systems differ significantly from those of larger animals like pigs.

  • Immune system variations: Species-specific differences in immune cell populations, cytokine networks, and mucosal immunity.

  • Dose scaling challenges: Significant differences in body weight require careful consideration for dose translation.

  • Pathogen tropism variations: Many pathogens show species-specific tissue preferences and virulence mechanisms.

  • Colonization dynamics: Salmonella vectors may colonize different species with varying efficiency and tissue distribution.

The literature explicitly acknowledges these limitations, stating that "the outcomes observed in mice cannot be extrapolated to pigs," and emphasizing that "further studies are necessary to verify the protective efficacy of rSC0016(pS-PlpE) in pigs" . This highlights the importance of using mouse models as a preliminary step, followed by validation in the target species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.