Recombinant Salmonella choleraesuis Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV)

Shipped with Ice Packs
In Stock

Description

Functional Role

PhnV is a membrane component of the ABC (ATP-binding cassette) transporter system responsible for importing 2-aminoethylphosphonate (2-AEP), a phosphonate compound used as a phosphorus source under phosphate-limiting conditions . Key functional attributes include:

PropertyDescription
Transport Substrate2-aminoethylphosphonate
Transport System TypeABC transporter (permease component)
Biological RelevanceFacilitates phosphorus acquisition in bacterial metabolism
HomologyPart of the TIGR03255 HMM family, conserved in Salmonella and related species

3.2. Experimental Use in Vaccine Development

While no direct studies on PhnV’s role in vaccines exist, attenuated S. choleraesuis strains have been engineered as vectors for heterologous antigen delivery (e.g., Pasteurella multocida PlpE) . This highlights the potential utility of S. choleraesuis membrane proteins like PhnV in synthetic biology platforms for vaccine design .

Evolutionary and Genomic Context

PhnV is encoded chromosomally in S. choleraesuis strain SC-B67. Comparative genomics reveals that ABC transporters for phosphonates are widespread in Salmonella serovars, reflecting adaptation to diverse environmental niches .

Future Directions

Further studies could explore:

  1. Structural Analysis: Cryo-EM or X-ray crystallography to resolve the permease’s 3D architecture.

  2. Metabolic Studies: Role of 2-AEP transport in Salmonella pathogenesis or survival.

  3. Biotechnological Applications: Engineering PhnV for biosensing or synthetic nutrient uptake systems.

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
phnV; SCH_0467; Putative 2-aminoethylphosphonate transport system permease protein PhnV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
phnV
Target Protein Sequence
MPIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKWLGQK
Uniprot No.

Target Background

Function
This protein is likely a component of the PhnSTUV complex (TC 3.A.1.11.5) involved in the import of 2-aminoethylphosphonate. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: sec:SCH_0467

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the phnV protein in Salmonella choleraesuis?

The phnV protein in Salmonella choleraesuis functions as a permease component of the 2-aminoethylphosphonate transport system. As part of the bacterial membrane transport machinery, it facilitates the movement of phosphonate compounds across the cell membrane, which are important for bacterial metabolism and survival. The protein belongs to the broader category of bacterial outer membrane proteins (OMPs) that contribute to pathogenicity and possess immunogenic properties . Similar to other membrane proteins, phnV likely plays a role in nutrient acquisition and may contribute to bacterial survival under phosphate-limited conditions.

How does the phnV gene fit into the genetic organization of Salmonella choleraesuis?

The phnV gene is part of the phn operon in Salmonella choleraesuis, which encodes multiple proteins involved in phosphonate uptake and metabolism. This gene is regulated along with other genes in response to phosphate limitation, typically through the PhoBR two-component regulatory system. When designing genetic studies involving phnV, researchers should consider its genetic context within the operon structure, as well as its relationship to other phosphate regulation pathways . Understanding these genetic relationships is crucial for experimental design in gene knockout or complementation studies.

What expression systems are most effective for producing recombinant phnV protein?

  • Temperature adjustment (typically lower temperatures of 16-25°C)

  • Induction optimization (lower IPTG concentrations for T7-based systems)

  • Use of specialized E. coli strains designed for membrane protein expression

Based on comparable studies with other membrane proteins, vector systems containing the asd gene complementation system have shown stable maintenance for over 50 generations in attenuated Salmonella strains, suggesting similar systems could be effective for phnV expression . For higher yield purification, fusion tags like His6 or MBP may improve solubility and facilitate purification.

What are the challenges in purifying the phnV protein for structural studies?

Purification of phnV protein presents several challenges common to membrane proteins:

  • Detergent selection: Different detergents (DDM, LDAO, etc.) must be screened to maintain protein stability during solubilization

  • Protein stability: Membrane proteins often denature easily once removed from the lipid bilayer

  • Functional assessment: Confirming that the purified protein retains its native conformation

Methodologically, a systematic approach involves:

  • Initial screening with a panel of at least 6-8 detergents at varying concentrations

  • Size exclusion chromatography to assess protein homogeneity

  • Functional assays to confirm transport activity

  • Western blot analysis to confirm expression and purity, as demonstrated in similar studies with recombinant proteins in Salmonella vectors

How can I design an effective gene knockout study to examine phnV function in Salmonella choleraesuis pathogenicity?

Designing an effective gene knockout study for phnV requires careful consideration of multiple factors:

  • Knockout strategy selection: Lambda Red recombination system offers efficiency for creating scarless deletions compared to traditional homologous recombination

  • Complementation controls: Include both the knockout and complemented strains to confirm phenotype specificity

  • Phenotypic assessments: Include multiple assays to evaluate:

    • Growth in phosphonate-limited media

    • Competitive index in mixed infections

    • Virulence in appropriate animal models

    • Transcriptional analysis of related phosphate-acquisition genes

When designing the experiment, consider approaches similar to those used in other Salmonella studies where gene deletion (like sopB knockout) has been successfully implemented to study pathogenicity . The experimental design should include appropriate controls and statistical power calculations similar to those used in case-control genetic studies, where sample size is determined based on expected effect size and desired power .

What strategies can improve the stability and expression of recombinant phnV in vaccine vector development?

For developing stable recombinant phnV expression in vaccine vectors, several strategies have proven effective:

  • Codon optimization: Adapt the phnV coding sequence to the preferred codon usage of Salmonella

  • Balanced lethal systems: Utilize complementation systems like the asd system where the phnV-containing plasmid complements an essential chromosomal deletion

  • Regulated delayed attenuation systems: Incorporate regulatory elements that allow full expression in vitro but attenuate in vivo

Implementation of a balanced lethal system similar to the pYA3943 prokaryotic plasmid containing pBR ori and asd genes has demonstrated stability for over 50 passages in recombinant vaccine strains . This approach creates selective pressure for plasmid maintenance without requiring antibiotic selection, which is crucial for vaccine applications.

For optimal expression, the integration of regulatory elements that respond to in vivo conditions can enhance vaccine effectiveness by ensuring appropriate timing of antigen delivery. This approach has been successfully utilized in recombinant attenuated Salmonella vectors expressing heterologous antigens .

How can I assess contradictions in phnV structural and functional data across different experimental methods?

When analyzing potentially contradictory data about phnV structure or function, a systematic approach using contradiction pattern analysis can help:

  • Identify interdependent data items: Determine which experimental results should theoretically align

  • Map contradictory dependencies: Document specific contradictions between experimental outcomes

  • Develop Boolean rules: Establish the minimum set of rules to evaluate these contradictions

This can be represented using the notation (α, β, θ) where:

  • α represents the number of interdependent data items

  • β represents the number of contradictory dependencies identified

  • θ represents the minimal number of Boolean rules needed to assess contradictions

For example, if comparing structural data from X-ray crystallography, cryo-EM, and molecular dynamics simulations of phnV, you might identify multiple potential contradictions regarding transmembrane domains or binding sites. The contradiction pattern might be classified as (3,4,2), indicating three interdependent methods, four identified contradictions, but only two fundamental Boolean rules needed to resolve them.

What immunological parameters should be measured when evaluating phnV as a potential vaccine antigen?

When evaluating phnV as a potential vaccine antigen, comprehensive immunological assessment should include:

  • Humoral immunity:

    • Antigen-specific IgG titers (ELISA)

    • Neutralizing antibody levels

    • Antibody subclass distribution (IgG1, IgG2a, etc.)

  • Cellular immunity:

    • T-cell responses via ELISPOT (IFN-γ, IL-4)

    • Intracellular cytokine staining

    • Lymphocyte proliferation assays

  • Mucosal immunity:

    • Secretory IgA in mucosal secretions

    • Mucosal T-cell responses

    • Gut-associated lymphoid tissue analysis

This multi-parameter approach is similar to that used in evaluating recombinant attenuated Salmonella vaccines expressing heterologous antigens, where combined assessment of mucosal, humoral, and cellular immune responses provided comprehensive evaluation of vaccine efficacy . For example, studies with recombinant Salmonella vectors have demonstrated the induction of mixed Th1/Th2 cellular immune responses alongside significant mucosal immune responses, providing protection against challenge with wild-type pathogens .

How should I design a case-control study to investigate genetic variations in the phnV gene across Salmonella strains?

Designing a rigorous case-control study to investigate phnV genetic variations requires:

  • Defined phenotype: Clearly articulate the phenotype of interest (e.g., virulence, antibiotic resistance)

  • Heritability assessment: Confirm the heritability of the phenotype through preliminary family or transmission studies

  • Appropriate control selection: Select controls from the same population background as cases

  • Sample size calculation: Perform power calculations based on expected effect size

For effective study design, consider:

ParameterRecommendationRationale
Case definitionPrecise clinical or phenotypic criteriaReduces heterogeneity
Control sourceSame population as casesMinimizes population stratification
Sample sizeBased on power calculation (minimum 80% power)Ensures ability to detect genetic effects
Genotyping approachTargeted sequencing or SNP arraysCost-effective for specific gene analysis

Following established protocols for genetic association studies, researchers should consider whether a population-based study is appropriate for their research question and calculate sample sizes using tools like Genetic Power Calculator or CaTS . The study should also address whether it is a de-novo or replication study, which affects interpretation standards.

What are the critical parameters for optimizing phnV protein purification for structural studies?

For optimizing phnV protein purification for structural studies, the following critical parameters should be systematically evaluated:

  • Detergent screening protocol:

    • Test a panel of 8-12 detergents at multiple concentrations

    • Assess protein stability via thermal shift assays

    • Monitor monodispersity via size exclusion chromatography

  • Buffer optimization:

    • pH range evaluation (typically pH 6.0-8.0)

    • Salt concentration (typically 100-500 mM NaCl)

    • Addition of stabilizing agents (glycerol, specific lipids)

  • Purification strategy:

    • Two-step minimum purification approach

    • Affinity chromatography followed by size exclusion

    • Optional ion exchange step for higher purity

  • Quality control metrics:

    • SDS-PAGE and Western blot analysis

    • Mass spectrometry confirmation

    • Circular dichroism for secondary structure verification

Each parameter should be optimized sequentially, documenting the effects on protein yield, purity, and stability. Similar methodologies have been employed for other membrane proteins and recombinant proteins expressed in Salmonella vectors .

How can I design experiments to resolve data contradictions in phnV functional characterization?

When faced with contradictory data regarding phnV function, strategic experimental design can help resolve inconsistencies:

  • Contradiction mapping: First, identify specific contradictions using the (α, β, θ) classification system to understand the nature and complexity of the contradictions

  • Orthogonal methods approach: Design experiments using methodologically distinct approaches to assess the same parameter

  • Controlled variable isolation: Systematically alter one variable at a time while maintaining others constant

  • Explicit hypothesis testing: Design experiments that directly test competing hypotheses explaining the contradictions

For example, if contradictory results exist regarding phnV substrate specificity, design experiments that:

  • Use both in vivo transport assays and in vitro binding studies

  • Test substrate binding under varying conditions (pH, temperature, ionic strength)

  • Compare results across different expression systems and purification methods

This approach aligns with structured contradiction analysis methods that have been applied in biomedical data quality assessment domains .

What statistical approaches are most appropriate for analyzing phenotypic effects of phnV mutations?

For analyzing phenotypic effects of phnV mutations, appropriate statistical approaches depend on the experimental design and data types:

  • For growth curve analysis:

    • Mixed-effects models accounting for repeated measures

    • Area under curve (AUC) comparisons with ANOVA or non-parametric alternatives

    • Growth rate parameter estimation using non-linear regression

  • For virulence studies:

    • Survival analysis using Kaplan-Meier curves and log-rank tests

    • Competitive index analysis using paired t-tests or Wilcoxon signed-rank tests

    • Bacterial burden comparisons using ANOVA with multiple comparison corrections

  • For transcriptomics data:

    • Differential expression analysis (DESeq2, edgeR)

    • Gene set enrichment analysis

    • Network analysis to identify affected pathways

When designing statistical analyses, researchers should perform proper sample size calculations based on expected effect sizes, similar to approaches used in genetic association studies . For complex phenotypes, multivariate analyses may be necessary to account for interactions between different factors.

How can I integrate structural predictions and experimental data to develop a comprehensive model of phnV function?

Developing a comprehensive model of phnV function through integrated analysis requires:

  • Multi-level data integration:

    • Sequence-based predictions (transmembrane domains, binding sites)

    • Homology modeling based on related permeases

    • Experimental biochemical data (substrate binding, transport kinetics)

    • Mutational analysis results

  • Iterative modeling approach:

    • Begin with in silico predictions

    • Refine with experimental constraints

    • Test model predictions experimentally

    • Update model based on new data

  • Validation strategies:

    • Cross-validation using data not used in model development

    • Prediction of novel mutations' effects with experimental verification

    • Comparative analysis with related transport systems

This integrated approach helps minimize contradictions in the data interpretation process by explicitly identifying and addressing potential sources of contradiction, similar to methods used for handling contradictions in complex biomedical datasets .

What are the best practices for analyzing immune responses to phnV-based vaccine candidates?

When analyzing immune responses to phnV-based vaccine candidates, follow these best practices:

  • Comprehensive immune profiling:

    • Analyze multiple immune parameters (antibodies, T-cells, cytokines)

    • Include both systemic and mucosal compartments

    • Assess functionality (neutralization, opsonization) not just quantity

  • Appropriate statistical analysis:

    • Use repeated measures ANOVA for longitudinal responses

    • Apply non-parametric tests for non-normally distributed data

    • Correct for multiple comparisons (Bonferroni or FDR methods)

  • Correlates of protection analysis:

    • Correlate immune parameters with protection outcomes

    • Use multivariate models to identify key protective factors

    • Develop predictive models of protection

This approach has been successfully implemented in studies of recombinant attenuated Salmonella vaccines, where comprehensive assessment of antigen-specific mucosal, humoral, and cellular immune responses provided clear differentiation between vaccine candidates . For example, studies have shown that recombinant Salmonella vaccines can induce higher antigen-specific responses than conventional inactivated vaccines, leading to enhanced protection rates (80% vs. 60% survival) and reduced tissue damage .

What advanced imaging techniques are most informative for studying phnV localization and dynamics?

For studying phnV localization and dynamics, several advanced imaging techniques offer complementary information:

  • Super-resolution microscopy:

    • STORM/PALM techniques achieve 20-30 nm resolution

    • Structured illumination microscopy (SIM) provides 100 nm resolution

    • Optimal for visualizing membrane protein clustering and domain organization

  • Live-cell imaging approaches:

    • Fluorescence recovery after photobleaching (FRAP) for mobility studies

    • Single-particle tracking for diffusion analysis

    • FRET-based approaches for protein-protein interactions

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence specificity with EM ultrastructural detail

    • Particularly valuable for membrane protein localization studies

    • Requires specialized sample preparation and imaging expertise

When implementing these techniques, researchers should consider appropriate controls and quantification methods similar to those used in studies of other membrane proteins and bacterial surface antigens .

How can I optimize the design of a recombinant Salmonella vector expressing phnV for vaccine development?

Optimizing a recombinant Salmonella vector expressing phnV for vaccine development requires addressing several key aspects:

  • Vector attenuation strategy:

    • Implement regulated delayed attenuation systems for optimal in vivo performance

    • Consider knockout of virulence genes like sopB to reduce intestinal inflammation

    • Balance attenuation with immunogenicity

  • Antigen expression optimization:

    • Design codon-optimized phnV sequence

    • Incorporate strong but regulated promoters

    • Include appropriate secretion signals for antigen delivery

  • Stability enhancement:

    • Utilize balanced lethal systems like the asd complementation system

    • Confirm plasmid stability for >50 generations without antibiotic selection

    • Test stability under various growth conditions

This methodology aligns with successful approaches used for other recombinant Salmonella Choleraesuis vectors expressing heterologous antigens, which demonstrated effective antigen delivery, specific immune responses, and protection against challenge . For example, the use of regulated delayed exogenous synthesis systems in Salmonella vectors has shown promising results for stable antigen expression and delivery .

What bioinformatic tools are most effective for predicting functional domains in phnV and related permease proteins?

For predicting functional domains in phnV and related permease proteins, several specialized bioinformatic tools demonstrate particular effectiveness:

  • Membrane topology prediction:

    • TMHMM and TOPCONS for transmembrane domain prediction

    • SignalP for signal peptide identification

    • PRED-TMBB for beta-barrel prediction in outer membrane proteins

  • Functional domain analysis:

    • InterProScan for comprehensive domain identification

    • HMMER for hidden Markov model-based domain searching

    • ConSurf for evolutionary conservation analysis

  • Structure prediction approaches:

    • AlphaFold2 for accurate tertiary structure prediction

    • Phyre2 for fold recognition and homology modeling

    • SWISS-MODEL for template-based modeling

  • Molecular docking tools:

    • AutoDock Vina for substrate binding prediction

    • HADDOCK for protein-protein interaction modeling

    • MDockPP for membrane protein-specific docking

When using these tools, researchers should implement a consensus approach, comparing predictions from multiple algorithms to identify consistently predicted features, similar to approaches used in studying other bacterial outer membrane proteins that contribute to pathogenicity and possess immunogenic properties .

What are the most promising applications of phnV research in vaccine development?

Research on phnV protein offers several promising applications for vaccine development:

  • Recombinant antigen delivery systems:

    • Using phnV as a component in recombinant attenuated Salmonella vaccine vectors

    • Potential for inducing robust mucosal, humoral, and cellular immune responses

    • Possible application in multi-antigen vaccination strategies

  • Structure-based vaccine design:

    • Identification of immunodominant epitopes within phnV

    • Design of epitope-focused vaccines with enhanced immunogenicity

    • Development of structure-stabilized immunogens

  • Adjuvant development:

    • Exploration of phnV-derived peptides as potential immune stimulants

    • Investigation of signaling pathways activated by phnV components

    • Development of targeted delivery systems

The development of recombinant attenuated Salmonella vectors has demonstrated significant potential as vaccine platforms, with studies showing enhanced immune responses and protection compared to conventional inactivated vaccines . Similar approaches using phnV as an antigen could yield promising results, particularly for vaccines targeting enteric pathogens.

How might future technologies enhance our understanding of phnV structure and function?

Emerging technologies that will likely enhance our understanding of phnV include:

  • Cryo-electron tomography:

    • Visualizing membrane proteins in their native cellular environment

    • Observing structural changes during transport processes

    • Resolution approaching 10Å for in situ studies

  • Time-resolved structural techniques:

    • Serial femtosecond crystallography at X-ray free electron lasers

    • Time-resolved cryo-EM

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Artificial intelligence approaches:

    • Enhanced structure prediction through deep learning

    • Improved functional annotation through machine learning

    • Network-based prediction of protein-protein interactions

  • Single-molecule techniques:

    • FRET-based conformational change detection

    • Force spectroscopy for energy landscape mapping

    • Single-molecule transport assays

These technologies will provide unprecedented insights into the dynamic behavior of membrane transport proteins like phnV, potentially resolving contradictions in current data and facilitating more effective experimental design through improved contradiction pattern analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.