Recombinant Salmonella choleraesuis Putative epimerase lsrE (lsrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lsrE; SCH_3969; Putative epimerase LsrE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
lsrE
Target Protein Sequence
MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLHERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_3969

Protein Families
Ribulose-phosphate 3-epimerase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for recombinant lsrE protein?

For optimal stability and activity of recombinant Salmonella choleraesuis Putative epimerase lsrE, the following storage and handling protocols are recommended:

  • Upon receipt, the lyophilized protein should be briefly centrifuged to bring contents to the bottom of the vial.

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and aliquot to minimize freeze-thaw cycles.

  • Store at -20°C/-80°C for long-term preservation.

  • Working aliquots can be stored at 4°C for up to one week.

  • Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity.

  • The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during storage .

These conditions are critical for maintaining protein activity for experimental procedures, especially for structural and functional studies.

How is recombinant Salmonella choleraesuis lsrE typically expressed and purified?

The recombinant expression and purification of Salmonella choleraesuis Putative epimerase lsrE typically follows these methodological steps:

  • Expression System Selection: The protein is commonly expressed in E. coli expression systems, which offer high yield and relatively straightforward cultivation requirements .

  • Vector Design: The lsrE gene (encoding all 254 amino acids) is cloned into an expression vector with an N-terminal His-tag for affinity purification.

  • Transformation and Expression: The construct is transformed into competent E. coli cells, followed by induction of protein expression under optimized conditions.

  • Cell Lysis: Bacterial cells are harvested and lysed to release the recombinant protein.

  • Affinity Purification: The His-tagged lsrE protein is purified using metal affinity chromatography (typically Ni-NTA resin).

  • Quality Control: The purified protein undergoes SDS-PAGE analysis to confirm purity (typically >90% as determined by SDS-PAGE) .

  • Final Processing: The purified protein is often lyophilized for stability and ease of storage, resulting in a lyophilized powder form.

This methodological approach ensures high-quality protein preparation suitable for structural studies, enzymatic assays, and immunological experiments.

What is the proposed enzymatic mechanism of lsrE and how can its activity be experimentally determined?

The putative epimerase activity of lsrE likely involves the following mechanistic steps:

  • Substrate Binding: The enzyme binds to its carbohydrate substrate through specific recognition domains.

  • Catalytic Conversion: As a putative epimerase, lsrE likely catalyzes the inversion of stereochemistry at a specific carbon center of the substrate.

  • Product Release: Following the epimerization reaction, the modified carbohydrate is released.

For experimental determination of lsrE activity, researchers should consider:

  • Spectrophotometric Assays: Coupling the epimerization reaction with a secondary reaction that produces a spectrophotometrically detectable product.

  • NMR Spectroscopy: For direct observation of changes in stereochemistry of the substrate.

  • HPLC Analysis: To separate and quantify substrate and product.

  • Coupled Enzyme Assays: Using downstream enzymes that specifically recognize the epimerized product.

  • Isotope Labeling: To track the movement of specific atoms during the epimerization reaction.

The enzymatic activity should be assessed under varying conditions (pH, temperature, metal ion concentrations) to determine optimal catalytic parameters and potential regulatory mechanisms.

How might lsrE function in Salmonella pathogenesis and what experimental approaches could elucidate its role?

While the specific role of lsrE in Salmonella pathogenesis is not fully characterized, several experimental approaches can help elucidate its function:

  • Gene Knockout Studies: Create lsrE deletion mutants in Salmonella choleraesuis and assess changes in virulence in appropriate infection models.

  • Transcriptomic Analysis: Compare gene expression profiles between wild-type and lsrE mutants under various infection-relevant conditions.

  • Host-Pathogen Interaction Studies: Examine how lsrE affects bacterial adhesion, invasion, or survival within host cells.

  • Metabolomic Analysis: Identify metabolic pathways affected by lsrE deletion or overexpression.

  • Structural Biology Approaches: Determine the three-dimensional structure of lsrE to identify potential interaction partners or substrates.

  • Heterologous Expression Systems: Similar to the approach used with recombinant attenuated Salmonella Choleraesuis vector rSC0016, which has been successfully employed to express and deliver heterologous antigens for vaccine development .

  • In vivo Imaging: Track the expression and localization of lsrE during different stages of infection.

These experimental approaches would provide comprehensive insights into the potential role of lsrE in Salmonella virulence mechanisms.

What challenges are associated with expressing and purifying enzymatically active lsrE, and how can they be addressed?

Researchers face several challenges when expressing and purifying enzymatically active lsrE:

  • Protein Solubility: As a bacterial enzyme, lsrE may form inclusion bodies when overexpressed in E. coli. This can be addressed by:

    • Optimizing expression temperature (typically lowering to 16-25°C)

    • Using solubility-enhancing fusion tags

    • Employing specialized E. coli strains designed for difficult protein expression

  • Preserving Enzymatic Activity: The purification process may compromise the native structure and activity of lsrE. Solutions include:

    • Including stabilizing agents in purification buffers

    • Optimizing buffer components based on preliminary stability studies

    • Using gentle elution conditions during affinity chromatography

  • Co-factor Requirements: If lsrE requires specific co-factors for activity, these should be identified and included in activity assays. Potential approaches include:

    • Metal ion screening

    • Cofactor supplementation experiments

    • Analysis of the protein sequence for cofactor binding motifs

  • Protein Purity: Achieving high purity without compromising activity requires:

    • Multi-step purification strategies (e.g., affinity chromatography followed by size exclusion)

    • Optimized washing steps to remove contaminants while preserving target protein

    • Quality control via multiple analytical methods (SDS-PAGE, mass spectrometry)

  • Storage Stability: As indicated in the product information, aliquoting with 6% trehalose and avoiding repeated freeze-thaw cycles are critical for maintaining stability .

How can recombinant lsrE be utilized in vaccine development research?

Recombinant lsrE could potentially be used in vaccine development through several strategic approaches:

  • Antigen Delivery Systems: Similar to how recombinant attenuated Salmonella Choleraesuis vectors have been used to deliver heterologous antigens, lsrE could be explored as a carrier protein or as part of a vector system. The rSC0016 vector system developed for Salmonella Choleraesuis has demonstrated success in delivering proteins like PlpE from Pasteurella multocida, inducing strong immune responses .

  • Immune Response Characterization:

    • The recombinant lsrE could be evaluated for its ability to induce humoral, cellular, and mucosal immune responses.

    • Testing could include assessment of antibody production, T-cell activation, and mucosal IgA levels.

  • Vaccine Formulation Studies:

    • Combining lsrE with appropriate adjuvants to enhance immunogenicity

    • Testing different delivery routes (oral, intranasal, parenteral) to optimize immune responses

    • Evaluating prime-boost strategies using different formulations

  • Protection Studies: Following the methodology used in the rSC0016(pS-PlpE) study, where immunized mice showed 80% survival against challenge with wild-type Pasteurella multocida , similar challenge studies could be designed to assess the protective efficacy of lsrE-based vaccines.

  • Comparative Studies: Comparing the efficacy of live attenuated vectors expressing lsrE with traditional inactivated vaccines, as was done in the case of rSC0016(pS-PlpE) which showed better protection than inactivated vaccine (80% vs. 60% survival) .

What structural biology techniques are most appropriate for studying lsrE, and what insights might they provide?

Several structural biology techniques can provide valuable insights into lsrE structure and function:

The insights from these studies could identify catalytic residues, substrate specificity determinants, and potential interaction partners, guiding the design of inhibitors or the engineering of lsrE with modified properties.

How can comparative genomic approaches enhance our understanding of lsrE function across Salmonella species?

Comparative genomic analysis of lsrE across Salmonella species can provide valuable evolutionary and functional insights:

  • Sequence Conservation Analysis:

    • Identify highly conserved residues likely critical for function

    • Detect variable regions that might confer species-specific properties

    • Create multiple sequence alignments to visualize conservation patterns

  • Phylogenetic Studies:

    • Construct phylogenetic trees to understand the evolutionary history of lsrE

    • Identify potential horizontal gene transfer events

    • Correlate lsrE sequence variations with pathogenicity differences among Salmonella species

  • Synteny Analysis:

    • Examine the genomic context of lsrE across species

    • Identify consistently co-located genes that might functionally interact with lsrE

    • Detect operon structures that provide clues to regulatory mechanisms

  • Structure Prediction:

    • Use homology modeling based on conserved domains

    • Predict functional sites based on evolutionary conservation patterns

    • Compare predicted structures across species to identify functional differences

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Correlate selection patterns with structural features

    • Identify potential host adaptation signatures

These approaches could reveal whether lsrE function is conserved across Salmonella species or has undergone adaptive evolution in specific lineages, providing insights into its role in bacterial physiology and pathogenesis.

What quality control measures should be implemented when working with recombinant lsrE?

Rigorous quality control is essential when working with recombinant lsrE to ensure experimental reproducibility:

  • Purity Assessment:

    • SDS-PAGE analysis (expecting >90% purity as indicated in the product specifications)

    • Mass spectrometry verification of molecular weight

    • Reversed-phase HPLC to detect impurities

  • Identity Confirmation:

    • Western blot using anti-His tag antibodies or specific anti-lsrE antibodies

    • Peptide mass fingerprinting

    • N-terminal sequencing to confirm correct protein sequence

  • Functional Validation:

    • Enzymatic activity assays specific to epimerase function

    • Thermal shift assays to assess protein folding and stability

    • Circular dichroism to evaluate secondary structure content

  • Contaminant Testing:

    • Endotoxin testing (particularly important for immunological studies)

    • Nucleic acid contamination assessment

    • Host cell protein quantification

  • Stability Monitoring:

    • Real-time and accelerated stability studies

    • Freeze-thaw cycle testing

    • Activity retention over time under recommended storage conditions

A comprehensive quality control table for recombinant lsrE might include:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE>90%
IdentityWestern blotPositive at expected MW
IdentityMass spectrometryWithin 0.1% of theoretical MW
EndotoxinLAL assay<0.1 EU/µg protein
ActivityEpimerase assay>80% of reference standard
AggregationSize exclusion chromatography<5% aggregates
ConcentrationBradford/BCA assayWithin 10% of label claim

What are the optimal conditions for setting up enzymatic assays with lsrE?

Optimizing enzymatic assays for lsrE requires systematic evaluation of multiple parameters:

  • Buffer Composition:

    • Test range of pH values (typically 6.0-9.0)

    • Evaluate different buffer systems (phosphate, Tris, HEPES)

    • Optimize ionic strength (50-200 mM typically)

  • Cofactor Requirements:

    • Screen divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)

    • Test cofactor concentrations (0.1-10 mM)

    • Evaluate potential requirement for coenzymes or prosthetic groups

  • Temperature and Time Course:

    • Determine temperature optimum (25-40°C typically)

    • Establish linear range of reaction over time

    • Define enzyme stability under assay conditions

  • Substrate Considerations:

    • Identify potential natural and synthetic substrates

    • Determine Km and Vmax values

    • Establish substrate concentration ranges that avoid inhibition

  • Detection System:

    • Select appropriate detection method (spectrophotometric, fluorometric, HPLC)

    • Optimize signal-to-noise ratio

    • Validate linearity of detection method

  • Controls and Validation:

    • Include negative controls (heat-inactivated enzyme)

    • Use positive controls (related enzymes with known activity)

    • Validate reproducibility across multiple protein batches

A standardized protocol should include careful documentation of all these parameters to ensure reproducibility across different laboratories and experimental settings.

How can lsrE be incorporated into multi-protein interaction studies to understand its role in bacterial metabolic networks?

To investigate lsrE's interactions within bacterial metabolic networks, several sophisticated approaches can be employed:

  • Protein-Protein Interaction Studies:

    • Pull-down assays using His-tagged lsrE as bait

    • Yeast two-hybrid or bacterial two-hybrid screening

    • Surface plasmon resonance (SPR) to quantify interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Interactome Mapping:

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

    • Proximity labeling techniques (BioID, APEX) in vivo

    • Co-immunoprecipitation followed by mass spectrometry

    • Protein microarrays to screen for interaction partners

  • Metabolic Pathway Analysis:

    • Metabolic flux analysis in wild-type vs. lsrE knockout strains

    • 13C labeling studies to track carbon flow through pathways

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Computational modeling of metabolic networks incorporating lsrE

  • Structural Complex Analysis:

    • Blue native PAGE to identify native protein complexes

    • Cryo-EM of multi-protein complexes

    • Protein-fragment complementation assays

    • FRET/BRET studies to detect interactions in real-time

  • In vivo Confirmation:

    • Fluorescence colocalization microscopy

    • Split reporter systems (luciferase, fluorescent proteins)

    • Genetic interaction studies (synthetic lethality, epistasis)

    • In vivo crosslinking followed by purification

These methodologies, when applied systematically, can reveal how lsrE integrates into broader metabolic networks and regulatory systems within Salmonella, potentially identifying novel therapeutic targets or vaccine candidates.

What are the current knowledge gaps concerning lsrE function and how might future research address them?

Despite available information on recombinant lsrE protein production and characterization , several critical knowledge gaps remain:

  • Functional Characterization:

    • The specific substrate(s) of lsrE remain unidentified

    • The exact role of lsrE in bacterial metabolism is not fully understood

    • Kinetic parameters and reaction mechanism need elucidation

  • Regulatory Context:

    • How lsrE expression is regulated in response to environmental cues

    • Whether lsrE is part of a larger operon or regulon

    • If lsrE expression changes during different phases of infection

  • Structural Information:

    • Three-dimensional structure of lsrE has not been determined

    • Substrate binding site architecture remains unknown

    • Potential allosteric regulation mechanisms are not characterized

Future research directions should include:

  • Comprehensive Substrate Screening: Using metabolomics and enzyme activity assays to identify natural substrates.

  • Transcriptional Regulation Studies: Investigating promoter architecture and transcription factor binding.

  • In vivo Role Determination: Creating knockout mutants and assessing phenotypic changes under various conditions.

  • Structural Biology Approaches: Solving the crystal structure to guide mechanistic studies and inhibitor design.

  • Integration with Systems Biology: Incorporating lsrE into metabolic models of Salmonella to predict its systemic role.

  • Comparative Analysis: Examining the role of lsrE homologs in other bacterial species, similar to how research has progressed with other Salmonella proteins in vector development .

Addressing these knowledge gaps would significantly advance our understanding of bacterial metabolism and potentially reveal new targets for antimicrobial development.

How can insights from recombinant attenuated Salmonella Choleraesuis vector research inform future studies with lsrE?

The successful development of recombinant attenuated Salmonella Choleraesuis vector rSC0016 for vaccine applications provides valuable insights for lsrE research:

  • Vector Design Principles:

    • The regulated delayed attenuation system used in rSC0016 could be applied to create lsrE expression systems

    • The balanced lethal system using Asd as a plasmid retention method demonstrated excellent stability over 50 passages

    • These design principles could be adapted for stable lsrE expression

  • Immune Response Characterization:

    • The comprehensive immune response analysis performed for rSC0016(pS-PlpE), including mucosal, humoral, and cellular immunity , provides a methodological framework

    • Similar approaches could be used to assess immune responses to lsrE if developed as a potential vaccine component

  • Protection Evaluation Strategies:

    • The challenge studies methodology showing 80% protection with rSC0016(pS-PlpE) offers a template for evaluating lsrE-based interventions

    • Comparative protection studies between different formulations can follow similar protocols

  • Translational Considerations:

    • The cautionary note that "outcomes observed in mice cannot be extrapolated to pigs" highlights the importance of species-specific testing

    • Cross-species validation should be incorporated into lsrE research plans

  • Vector Construction Methodology:

    • The plasmid construction and verification approaches, including PCR amplification, enzyme digestion, and sequence verification , provide robust protocols

    • Western blot verification of protein expression offers a template for confirming lsrE expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.