Recombinant Salmonella choleraesuis Putative protein-disulfide oxidoreductase (SCH_3138)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
dsbI; SCH_3138; Protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
dsbI
Target Protein Sequence
MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCV YIRYAMFVMVIGGVIAAINPKNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPD SLFGVQGCSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPIVPDGVTLSSVQQWFVDLYQQ SEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins. It is part of a redox system, along with DsbI and DsbL, that facilitates the formation of a crucial disulfide bond in AssT.
Database Links

KEGG: sec:SCH_3138

Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of putative protein-disulfide oxidoreductase (SCH_3138) in Salmonella choleraesuis?

Protein disulfide oxidoreductases are ubiquitous redox enzymes that catalyze dithiol-disulfide exchange reactions, characterized by CXXC sequence motifs at their active sites . SCH_3138, as a putative protein-disulfide oxidoreductase in Salmonella choleraesuis, likely facilitates the formation, reduction, and isomerization of disulfide bonds in bacterial proteins. Similar enzymes in other organisms demonstrate both oxidative/reductive activity and isomerase activity, with distinct functional contributions from each active site . In bacterial systems, these enzymes typically contribute to proper protein folding, particularly for secreted virulence factors and surface proteins that require disulfide bonds for structural stability.

Methodological approach: To confirm the functional role of SCH_3138, researchers should:

  • Perform sequence alignment with characterized protein-disulfide oxidoreductases

  • Identify conserved CXXC motifs

  • Conduct redox activity assays using standard substrates like insulin

  • Measure both oxidase and reductase activities using appropriate redox-sensitive fluorescent probes

  • Create knockout mutants to assess phenotypic changes

How should researchers approach the cloning and expression of recombinant SCH_3138?

When cloning and expressing SCH_3138, researchers should consider the following methodological approach:

  • Gene identification and primer design: Use whole-genome sequences of Salmonella choleraesuis to identify the SCH_3138 gene and design primers with appropriate restriction sites.

  • Expression vector selection: Select vectors similar to pYA3943, which contains balanced lethal systems (e.g., asd gene complementation) for stable maintenance in attenuated Salmonella strains .

  • Verification protocol:

    • Confirm successful construction by PCR amplification

    • Verify using restriction enzyme digestion (e.g., EcoRI and SalI)

    • Validate by DNA sequencing

    • Confirm protein expression via Western blot analysis using appropriate antisera

  • Stability assessment: Evaluate plasmid stability through serial passages (at least 50 generations) with restriction digestion verification at regular intervals .

Expression parameters table:

ParameterRecommended ConditionValidation Method
Expression systemAttenuated S. choleraesuis (e.g., rSC0016)Growth curve analysis
VectorBalanced-lethal system (asd-based)Plasmid stability over 50 passages
InductionArabinose-inducible promoterWestern blot quantification
Growth conditions37°C, aerobic, LB mediumOD600 measurements
Expression verificationWestern blot with anti-His or custom antibodyBand at expected molecular weight

What experimental design is optimal for characterizing the enzymatic properties of SCH_3138?

A comprehensive experimental design for characterizing SCH_3138 should include:

  • Purification strategy:

    • IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • Size exclusion chromatography for final polishing

    • Quality assessment via SDS-PAGE and Western blotting

  • Enzymatic activity assays:

    • Oxidative activity: insulin turbidity assay

    • Reductive activity: DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) reduction

    • Isomerase activity: scrambled RNase refolding assay

  • Kinetic parameters determination:

    • Substrate concentration series

    • Temperature and pH optima determination

    • Metal ion dependence evaluation

  • Site-directed mutagenesis of CXXC active sites to determine the specific roles of each redox site, similar to the C35S and C146S mutations approach used for PfPDO .

Following the experimental design principles in search result , researchers should:

  • Clearly define independent variables (e.g., substrate concentration, pH, temperature)

  • Identify dependent variables (e.g., enzymatic activity rates)

  • Control extraneous variables (e.g., buffer composition, protein purity)

  • Utilize appropriate controls (e.g., heat-inactivated enzyme, known PDO enzymes)

How can researchers differentiate between the oxidase, reductase, and isomerase activities of SCH_3138?

The differentiation between multiple enzymatic activities requires specific assays for each function:

  • Oxidase activity measurement:

    • Monitor the formation of disulfide bonds in reduced peptide substrates

    • Use fluorescence-quenched peptide substrates where fluorescence increases upon oxidation

    • Quantify using spectrofluorometric methods

  • Reductase activity assessment:

    • Measure the reduction of disulfide-containing substrates

    • Use DTNB assay to detect free thiols generated

    • Monitor decrease in absorbance at 340 nm with NADPH as electron donor

  • Isomerase activity evaluation:

    • Use scrambled RNase A with incorrect disulfide bonds

    • Measure recovery of RNase activity as indication of isomerase function

    • Monitor spectrophotometrically using cCMP (cytidine 2',3'-cyclic monophosphate) as substrate

Comparative activity table for interpretation:

Activity TypePositive ControlNegative ControlExpected SCH_3138 ActivityAffected by Active Site Mutation?
OxidaseDsbABuffer aloneModerate to highYes, CPYC site mutation
ReductaseDsbDHeat-inactivated enzymeLow to moderateYes, CPYC site mutation
IsomerasePDIReducing agent onlyDetectableYes, requires both active sites

How can researchers assess the role of SCH_3138 in Salmonella choleraesuis virulence?

To evaluate SCH_3138's contribution to virulence:

  • Generate defined mutants:

    • Create SCH_3138 knockout strain using lambda Red recombinase system

    • Develop active site mutants (CXXC to CXXS) to preserve structure but eliminate function

    • Complement with wild-type SCH_3138 on a plasmid for verification

  • In vitro virulence assays:

    • Adhesion and invasion assays using epithelial cell lines

    • Survival within macrophages

    • Biofilm formation capacity

    • Resistance to oxidative stress (H₂O₂ challenge)

  • Mouse model studies:

    • Compare colonization of wild-type vs. mutant strains

    • Assess bacterial burden in organs (spleen, liver, Peyer's patches)

    • Measure survival rates following intraperitoneal challenge

    • Evaluate tissue pathology

  • Transcriptomic/proteomic analysis:

    • RNA-Seq to identify differentially expressed genes in the mutant

    • Proteomic analysis focusing on secreted proteins and surface structures

    • Identify misfolded proteins in SCH_3138 mutants

This approach follows similar methodologies to those used in assessing recombinant attenuated Salmonella vaccines, where challenge studies evaluate protection rates and tissue pathology .

What is the potential of SCH_3138 as an antigen in recombinant Salmonella vaccine development?

To evaluate SCH_3138 as a vaccine antigen:

  • Antigenicity assessment:

    • In silico epitope prediction

    • ELISA assays using sera from infected animals

    • T-cell epitope mapping

  • Expression system development:

    • Construct similar to rSC0016(pS-PlpE) but expressing SCH_3138

    • Verify expression and secretion via Western blot

    • Confirm plasmid stability over multiple passages

  • Immunization protocol:

    • Oral administration regimen (e.g., two doses, 3 weeks apart)

    • Measure antigen-specific responses:

      • Mucosal immunity (IgA in intestinal lavage)

      • Humoral immunity (serum IgG titers)

      • Cellular immunity (mixed Th1/Th2 responses)

  • Challenge studies:

    • Intraperitoneal challenge with virulent Salmonella

    • Monitor survival rates (aim for >80% protection)

    • Assess tissue pathology reduction

Based on similar studies with the PlpE antigen, researchers should expect that a properly designed recombinant attenuated Salmonella vector can efficiently deliver heterologous antigens in vivo and induce specific immune responses against the target antigen .

What are the evolutionary relationships between SCH_3138 and other protein disulfide oxidoreductases across domains of life?

For phylogenomic analysis:

  • Comprehensive sequence analysis:

    • Collect PDO sequences from diverse organisms (bacteria, archaea, eukaryotes)

    • Perform multiple sequence alignment focusing on active site regions

    • Identify conserved motifs and domain architecture

  • Phylogenetic reconstruction:

    • Maximum likelihood methods for tree building

    • Bayesian inference to assess node support

    • Character mapping of key functional residues

  • Comparative genomic context:

    • Analyze gene neighborhoods across species

    • Identify co-evolved gene clusters

    • Assess horizontal gene transfer events

  • Functional evolution analysis:

    • Compare substrate specificities across evolutionary distances

    • Examine conservation of activity profiles (oxidase vs. reductase vs. isomerase)

    • Reconstruct ancestral sequences and test their functions

Evidence suggests that archaeal PDOs may be ancestors of eukaryotic PDI and belong to a novel protein disulfide oxidoreductase family . Similar analysis for SCH_3138 could reveal its evolutionary origins and relationship to other bacterial systems.

What are the common challenges in expressing and purifying functional SCH_3138, and how can researchers overcome them?

Common challenges and solutions:

  • Insoluble protein expression:

    • Reduce expression temperature (16-25°C)

    • Co-express with molecular chaperones

    • Optimize induction conditions (concentration, timing)

    • Use solubility-enhancing fusion tags (MBP, SUMO)

  • Inactive enzyme recovery:

    • Include redox buffer components during purification

    • Maintain reduced environment with DTT or β-mercaptoethanol

    • Perform on-column refolding for inclusion bodies

    • Use mild detergents to maintain native conformation

  • Low yield issues:

    • Optimize codon usage for expression host

    • Scale up culture volumes

    • Test different media formulations

    • Consider fed-batch cultivation

  • Plasmid instability:

    • Use balanced-lethal systems as demonstrated with Asd

    • Monitor growth curves to identify growth defects

    • Verify protein expression at various passage numbers

    • Compare growth rates with vector-only controls

Optimization table for expression:

ParameterInitial SettingOptimization RangeMonitoring Method
Temperature37°C16-37°CSDS-PAGE/Western blot
Inducer concentration0.2% arabinose0.002-0.2%Activity assay
Expression time4 hours2-24 hoursTime-course sampling
MediaLBLB, TB, M9, auto-inductionYield comparison
Cell density at inductionOD600 0.6OD600 0.4-1.0Growth curve analysis

How can researchers optimize experimental conditions for studying SCH_3138 enzymatic activity?

For optimal enzymatic activity characterization:

  • Buffer optimization:

    • Screen pH range (pH 5.0-9.0)

    • Test various buffer systems (phosphate, HEPES, Tris)

    • Evaluate salt concentration effects (50-500 mM NaCl)

    • Assess requirement for reducing agents (GSH, DTT)

  • Temperature optimization:

    • Determine temperature optima (25-42°C for mesophilic activity)

    • Evaluate thermal stability with differential scanning fluorimetry

    • Measure activity retention after heat treatment

  • Cofactor requirements:

    • Test divalent cations (Mg²⁺, Ca²⁺, Zn²⁺, Mn²⁺)

    • Evaluate nucleotide cofactors (ATP, GTP)

    • Assess glutathione redox system components

  • Substrate specificity determination:

    • Screen various protein and peptide substrates

    • Measure enzyme kinetics (Km, Vmax, kcat)

    • Develop high-throughput fluorescence-based assays

Based on studies with PfPDO, researchers should prepare for the possibility of cation-dependent ATPase activity with basic pH optimum . Systematic optimization using multi-factorial experimental design approaches can efficiently identify optimal conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.