Recombinant Salmonella choleraesuis Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

ParameterDetails
Expression SystemE. coli (His-tagged variants)
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol, pH optimized
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Recombinant glpG is produced via heterologous expression in E. coli, with His-tags enabling affinity chromatography purification . The protein is lyophilized for storage and reconstituted in deionized water or buffer containing trehalose for stability .

Research Applications and Implications

ApplicationDetails
Vaccine DevelopmentSalmonella vectors (e.g., rSC0016) are used to express heterologous antigens, though glpG itself is not directly utilized in this context .
Structural StudiesMutant glpG variants (e.g., Ser201Ala, His254Ala) enable mechanistic dissection of gate dynamics and substrate specificity .
Therapeutic TargetsRhomboid proteases are explored for antimicrobial or anticancer strategies, though S. choleraesuis glpG’s potential remains unexplored .

While glpG has not been directly studied in S. choleraesuis, its homologs in other pathogens highlight its role in membrane protein quality control, suggesting potential as a therapeutic target .

Comparative Analysis of Recombinant glpG Across Salmonella Strains

StrainUniprot IDTagExpression HostKey Features
S. choleraesuisQ57IV1N/AE. coliFull-length (1–276 aa), Tris/glycerol buffer
S. HeidelbergB4TKV0HisE. coliHis-tagged, >90% purity
S. DublinB5FKE3HisE. coliSequence homology to S. choleraesuis glpG

This table highlights conserved features (e.g., full-length expression, E. coli systems) and strain-specific modifications (e.g., His-tagging).

Research Gaps and Future Directions

  • Functional Studies: Direct characterization of S. choleraesuis glpG’s substrates and physiological roles remains limited.

  • Therapeutic Potential: Investigations into glpG inhibition for combating Salmonella infections are warranted.

  • Structural Insights: Cryo-EM or NMR studies could resolve glpG’s conformational dynamics, akin to E. coli GlpG .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
glpG; SCH_3455; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMIACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVV SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: sec:SCH_3455

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid protease glpG and what is its functional role in Salmonella choleraesuis?

Rhomboid protease glpG (UniProt: Q57IV1) is an intramembrane serine protease (EC 3.4.21.105) found in Salmonella choleraesuis. Based on studies of similar rhomboid proteases in related bacteria, glpG is involved in membrane protein quality control, specifically targeting components of respiratory complexes . The enzyme functions by cleaving the transmembrane domains of substrate proteins, allowing for subsequent degradation when these proteins become orphaned or fail to incorporate into functional complexes . This quality control mechanism helps protect cells from the potentially damaging effects of unincorporated membrane proteins.

What are the optimal storage conditions for recombinant Salmonella choleraesuis Rhomboid protease glpG?

For optimal stability, recombinant Salmonella choleraesuis Rhomboid protease glpG should be stored at -20°C in a Tris-based buffer containing 50% glycerol . For extended storage periods, -80°C is recommended . Importantly, repeated freezing and thawing cycles should be avoided to maintain protein integrity . Working aliquots can be stored at 4°C for up to one week . Creating multiple small aliquots upon initial receipt is advisable to minimize freeze-thaw cycles that could compromise protein activity.

How should researchers design expression systems for recombinant Salmonella choleraesuis Rhomboid protease glpG?

When designing expression systems for membrane proteins like rhomboid proteases, several factors require careful consideration:

Expression System ComponentRecommendationRationale
Host strainE. coli C41(DE3) or C43(DE3)These strains are engineered for membrane protein expression with reduced toxicity
VectorpET or pBAD seriesProvide tunable expression levels with strong but controllable promoters
Induction conditionsLow temperature (16-20°C), reduced inducer concentrationPromotes proper folding and membrane insertion
Fusion tagsHis-tag for purification; optional MBP/SUMO for solubilityFacilitates purification while potentially enhancing expression
SolubilizationMild detergents (DDM, LMNG)Preserves structural integrity and enzymatic activity

The expression construct should account for the challenging nature of membrane protein expression, with particular attention to codon optimization, signal sequences, and the incorporation of appropriate purification tags that don't interfere with the protein's catalytic activity.

What methods can be used to verify the activity of purified recombinant Salmonella choleraesuis Rhomboid protease glpG?

Verification of enzymatic activity requires appropriate experimental design:

  • Substrate selection: Based on related rhomboid studies, potential substrates include components of respiratory complexes such as HybA and FdoH .

  • Activity assays: A standard workflow includes:

    • Reconstitution of purified enzyme in detergent micelles or liposomes

    • Incubation with substrate at physiological temperature (37°C)

    • Detection of cleavage products via Western blotting or mass spectrometry

  • Essential controls:

    • Catalytically inactive mutant (S201A) as negative control

    • Known rhomboid substrates as positive controls

    • Time-course analysis to establish reaction kinetics

  • Confirmatory approaches:

    • Mass spectrometric analysis to identify precise cleavage sites

    • Inhibitor sensitivity studies using known rhomboid inhibitors

What approaches are effective for identifying novel substrates of Salmonella choleraesuis Rhomboid protease glpG?

Multiple complementary approaches can be employed to identify potential substrates:

  • Bioinformatic screening: Analyze the Salmonella choleraesuis proteome for proteins with:

    • Type I or Type III membrane topology (periplasmic N-terminus, cytosolic C-terminus)

    • Transmembrane domains containing helix-destabilizing residues

    • Structural similarities to known rhomboid substrates

  • Experimental substrate screening:

    • Construct artificial substrate libraries with reporter systems

    • Replace known substrate TMDs with candidate TMDs plus 16 residues at the periplasmic aspect

    • Compare cleavage patterns between wild-type and catalytically inactive protease (S201A)

  • Comparative proteomics:

    • Compare membrane proteomes of wild-type and glpG knockout strains

    • Focus on accumulated proteins in the knockout strain as potential substrates

How does the substrate specificity of Salmonella choleraesuis Rhomboid protease glpG compare with rhomboid proteases from other bacterial species?

Studies of related bacterial rhomboid proteases provide insights into potential substrate specificity patterns:

  • Substrate recognition determinants: Rather than strict sequence motifs, rhomboid proteases recognize structural features including:

    • Helix-destabilizing residues within the transmembrane domain

    • Accessibility of the scissile bond to the catalytic site

    • Specific residue positions relative to the cleavage site

  • Comparative analysis: Research on Shigella sonnei rhomboids revealed:

    • GlpG cleaves components of respiratory complexes including HybA and FdoH

    • Rhom7, another rhomboid protease, cleaves HybA and FdnH

    • This substrate overlap suggests functional redundancy but also specialization

  • Evolutionary implications: The conservation of rhomboid proteases across bacterial species suggests this quality control mechanism is ancient and likely critical for cellular function .

What role might Salmonella choleraesuis Rhomboid protease glpG play in pathogenesis and bacterial survival in host environments?

While direct evidence for glpG's role in Salmonella pathogenesis remains to be fully elucidated, several hypotheses can be proposed:

  • Membrane integrity maintenance: By facilitating quality control of orphan membrane proteins, glpG may contribute to membrane homeostasis during infection-related stress conditions.

  • Metabolic adaptation: Through regulation of respiratory complexes, glpG could influence bacterial adaptation to variable oxygen conditions encountered during infection.

  • Vector development implications: Understanding glpG function could enhance the design of recombinant attenuated Salmonella Choleraesuis vaccine vectors, which have shown promising results in experimental models .

  • Therapeutic target potential: As membrane protein quality control is essential for bacterial fitness, glpG could represent a novel target for antimicrobial development.

How can structural insights into Salmonella choleraesuis Rhomboid protease glpG inform functional studies?

Structural understanding of rhomboid proteases provides crucial insights for research:

  • Catalytic mechanism: The serine-histidine catalytic dyad embedded approximately 10 Å below the membrane surface creates a unique proteolytic environment . This positioning influences:

    • Substrate accessibility requirements

    • Water molecule access for hydrolysis

    • Potential for specific inhibitor design

  • Conformational dynamics: Rhomboid proteases form initial "interrogation complexes" with potential substrates before catalysis occurs , suggesting:

    • Rate-driven rather than affinity-driven proteolysis

    • Potential allosteric regulation mechanisms

    • Structural changes during substrate engagement

  • Structure-guided mutations: Knowledge of the catalytic mechanism enables specific mutations:

    • S201A mutation for creating catalytically inactive controls

    • Targeted mutations to alter substrate specificity

    • Modifications to investigate potential regulatory mechanisms

What are common challenges in experimental work with recombinant Salmonella choleraesuis Rhomboid protease glpG and how can they be addressed?

Working with membrane proteins like rhomboid proteases presents several technical challenges:

ChallengeManifestationSolution Approaches
Low expression levelsWeak bands on Western blots, poor yield- Optimize codon usage for expression host
- Lower induction temperature (16-20°C)
- Use specialized membrane protein expression strains
Protein aggregationInclusion body formation, loss of activity- Reduce inducer concentration
- Add mild detergents during lysis
- Explore fusion partners that enhance solubility
Maintaining native structureLoss of activity after purification- Screen multiple detergents (DDM, LMNG)
- Include lipids during purification
- Consider nanodiscs or amphipols for a more native environment
Activity verificationInconsistent assay results- Use freshly prepared protein
- Include appropriate positive and negative controls
- Ensure membrane-like environment for activity assays

What considerations are important when designing genetic studies to investigate glpG function in Salmonella choleraesuis?

Genetic manipulation strategies must be carefully planned:

  • Knockout construction:

    • Consider possible essentiality - glpG might be required for bacterial viability

    • Design clean deletions to avoid polar effects on adjacent genes

    • Include appropriate selection markers for screening

  • Complementation studies:

    • Use vectors with controllable expression to avoid toxicity

    • Ensure proper membrane targeting of complemented protein

    • Include epitope tags that don't interfere with function

  • Site-directed mutagenesis:

    • Target the catalytic residues (S201, H254) for activity studies

    • Modify potential substrate-binding regions to alter specificity

    • Create chimeric proteins to investigate domain functions

  • Phenotypic analysis:

    • Examine growth under various conditions (aerobic/anaerobic)

    • Test membrane integrity and stress responses

    • Analyze respiratory complex formation and function

How can researchers distinguish between direct and indirect effects of glpG activity in experimental systems?

Distinguishing direct from indirect effects requires methodological rigor:

  • Direct substrate verification:

    • In vitro cleavage assays with purified components

    • Site-directed mutagenesis of putative cleavage sites

    • Time-course analysis to establish precursor-product relationships

  • Substrate trapping approaches:

    • Use catalytically inactive mutants to trap substrate interactions

    • Perform crosslinking studies to capture transient interactions

    • Employ proximity labeling techniques to identify proteins in close proximity

  • Targeted vs. global analyses:

    • Focused studies on specific respiratory complex components

    • Global proteomic profiling to identify accumulated substrates

    • Integration of transcriptomic data to differentiate primary from secondary effects

How might understanding Salmonella choleraesuis Rhomboid protease glpG contribute to vaccine development strategies?

Research on recombinant attenuated Salmonella Choleraesuis vectors provides context for potential applications:

  • Vector optimization: Understanding glpG's role in membrane protein quality control could inform the design of more effective vaccine vectors by:

    • Optimizing membrane protein display systems

    • Enhancing vector stability in vivo

    • Improving antigen processing and presentation

  • Current vaccine vector research shows:

    • Recombinant attenuated S. Choleraesuis vector rSC0016 effectively delivers heterologous proteins in vivo

    • These vectors induce robust mucosal, humoral, and cellular immune responses

    • Immunized mice showed 80% survival against challenge compared to 60% for inactivated vaccines

  • Potential innovations:

    • Engineering glpG activity to optimize antigen processing

    • Developing regulated expression systems that enhance immunogenicity

    • Creating multivalent vectors expressing multiple antigens

What comparative approaches would be valuable for understanding rhomboid protease function across bacterial species?

Comparative studies offer powerful insights into evolutionary and functional aspects:

  • Phylogenetic analysis:

    • Compare rhomboid sequences across diverse bacterial phyla

    • Identify conserved versus variable regions

    • Correlate sequence features with known substrate preferences

  • Functional complementation:

    • Test whether rhomboids from different species can substitute for each other

    • Identify species-specific versus universal aspects of function

    • Create chimeric proteins to map functional domains

  • Substrate conservation:

    • Determine whether substrates like HybA and FdoH are conserved targets across species

    • Identify species-specific substrates that might reflect ecological adaptations

    • Develop predictive models for substrate recognition across bacterial species

How might advances in structural biology and protein engineering impact future research on Salmonella choleraesuis Rhomboid protease glpG?

Emerging technologies promise to enhance our understanding:

  • Cryo-electron microscopy advances:

    • Potential for high-resolution structures of glpG in different conformational states

    • Visualization of substrate-enzyme complexes

    • Insights into membrane interactions and substrate gating mechanisms

  • Protein engineering applications:

    • Designer rhomboids with altered substrate specificity

    • Photo-activatable or chemically inducible variants for temporal control

    • Biosensor development for monitoring membrane protein quality control in vivo

  • Computational approaches:

    • Molecular dynamics simulations of membrane-embedded enzyme function

    • Machine learning for substrate prediction

    • Systems biology models integrating rhomboid function into cellular networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.