Recombinant Salmonella choleraesuis sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

UgpA is a permease component of the ABC transporter system responsible for sn-glycerol-3-phosphate uptake, a critical carbon and phospholipid precursor. Key functional insights:

  • Nutrient Acquisition: Facilitates glycerol-3-phosphate import under phosphate-limiting conditions, enhancing bacterial survival in nutrient-poor environments .

  • Virulence Link: Genomic studies associate ugpA with virulence in Salmonella serovars, including systemic infections in swine and humans .

  • Regulation: Expression is modulated by phosphate availability via the PhoBR two-component system .

Applications in Vaccine Development

Recombinant UgpA has been leveraged in attenuated Salmonella vectors for heterologous antigen delivery:

StudyKey Findings
Attenuated S. TyphimuriumExpression of S. choleraesuis O-antigen in Δasd mutants induced cross-protective immunity in mice .
Recombinant S. CholeraesuisEngineered strain rSC0016(pS-PlpE) expressing Pasteurella multocida PlpE elicited 80% survival post-challenge in mice .
Antibody ResponseImmunization triggered IgG/IgA against heterologous antigens, confirming UgpA’s role in antigen presentation .

Production and Purification Protocols

  • Host Systems: E. coli, yeast, baculovirus, or mammalian cells .

  • Vector Design: Asd⁺ plasmids (e.g., pCZ1, pYA3943) with O-antigen gene clusters ensure stable expression .

  • Yield: Optimized using arabinose-inducible promoters or constitutive systems .

Genomic and Evolutionary Insights

  • Conservation: ugpA is highly conserved across Salmonella serovars but absent in non-pathogenic strains .

  • Mobile Genetic Elements: Associated with phage-integrated virulence genes (e.g., cfaE, arnA) and antibiotic resistance markers (e.g., sul, bla TEM-1) .

Challenges and Future Directions

  • Antibiotic Resistance: Plasmid-mediated resistance genes in ugpA-bearing strains complicate treatment .

  • Vaccine Optimization: Balancing attenuation and immunogenicity remains critical for vector-based platforms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; SCH_3485; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
ugpA
Target Protein Sequence
MSSFRPVFRSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLENFV ALFHDSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAA LQSIPRSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVVNLVYAFFDTFPVIDAATAG GPVQATTTLIYKIYREGFTGLDLSASAAQSVVLMFLVIILTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein plays a role in the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: sec:SCH_3485

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugp-dependent transport system in Salmonella and how does it relate to sn-glycerol-3-phosphate uptake?

The ugp-dependent transport system in Salmonella is a secondary transport mechanism for sn-glycerol-3-phosphate that becomes active under phosphate starvation conditions. This system complements the primary glpT-dependent transport system, which is inducible by growth on glycerol and sn-glycerol-3-phosphate. In Salmonella typhimurium, research has demonstrated that both transport systems function to internalize sn-glycerol-3-phosphate, with the ugp system specifically activated during phosphate limitation as a physiological adaptation mechanism .

How does the genetic organization of the ugp transport system differ from the glpT system?

The ugp transport system genes are organized distinctly from the glpT system. While glpT maps at approximately 47 minutes on the S. typhimurium linkage map (37% cotransducible with gyrA) and forms part of an operon with glpQ, the ugp system has a separate genetic organization. The ugp system contains multiple components including ugpA, which encodes the permease protein component of the transport system. Unlike the glpT-dependent system that is induced by growth substrates, the ugp system is regulated primarily through phosphate availability, demonstrating different genetic control mechanisms despite similar substrate specificity .

What experimental approaches are used to study ugpA expression and regulation?

To study ugpA expression and regulation, researchers typically employ:

  • Growth studies under phosphate limitation conditions to induce expression

  • Gene cloning and expression in vector systems (similar to the approach used for glpT)

  • Transport assays measuring uptake of radiolabeled sn-glycerol-3-phosphate

  • Mutant analyses using resistance selection (similar to fosfomycin resistance used for glpT mutants)

  • Protein characterization techniques including SDS-PAGE for molecular weight determination

These methodological approaches allow researchers to characterize the functional properties of ugpA and its role in the larger ugp transport system .

How do experimental design factors impact the study of ugpA transport kinetics?

Experimental design is critical when studying ugpA transport kinetics to avoid confounding variables that could lead to misinterpretation of results. Researchers should consider:

  • Cell growth conditions - phosphate availability directly affects ugp system expression

  • Induction timing - determination of optimal phosphate starvation periods

  • Transport assay parameters - temperature, substrate concentrations, and incubation times

  • Control experiments - comparison with wild-type and mutant strains

What are the key differences between ugpA in Salmonella choleraesuis and related proteins in other bacterial species?

While specific comparative data for ugpA between Salmonella choleraesuis and other species is limited in the provided search results, we can infer from related research that:

  • The permease components of glycerol-3-phosphate transport systems show structural and functional similarities across different bacterial species

  • The ugp system is present in both Salmonella and E. coli, suggesting evolutionary conservation

  • The regulatory mechanisms (phosphate starvation response) appear similar across species

  • Protein characteristics likely show species-specific adaptations

For comparison, we know that the glpT permease in S. typhimurium demonstrates distinct kinetic properties compared to its E. coli counterpart (Km of 50 μM vs. 14 μM, respectively), although both maintain similar maximum transport velocities (Vmax of 2.2 nmol/min · 10^8 cells) .

How should researchers design experiments to avoid confounding when studying recombinant ugpA expression?

To avoid experimental confounding when studying recombinant ugpA expression, researchers should:

  • Implement consistent DNA extraction methods across all samples

  • Use the same expression vectors and host systems for all experimental conditions

  • Control for plate-to-plate variation in growth and expression assays

  • Validate protein expression using multiple detection methods

  • Include appropriate positive and negative controls in all experiments

What methodological approaches can resolve data inconsistencies in ugpA functional studies?

When researchers encounter data inconsistencies in ugpA functional studies, the following methodological approaches can help resolve them:

  • Replicate studies with improved controls: Implement more rigorous control experiments that account for all potential variables affecting transport activity.

  • Cross-validation with multiple techniques: Compare results from different experimental approaches (e.g., transport assays, binding studies, structural analyses) to identify consistent patterns.

  • Statistical validation: Apply appropriate statistical methods to distinguish genuine effects from experimental variation, while avoiding the pitfall of merely using statistics to "clean up" fundamentally flawed experimental designs.

  • Hypothesis-driven testing: Ensure that experiments are designed to test specific falsifiable hypotheses about ugpA function rather than conducting purely associative studies.

  • Careful examination of outliers: Rather than automatically discarding outlier data points, investigate whether they reveal important insights about system behavior under specific conditions.

This approach aligns with the critical perspective that "the GWAS research community has too often accommodated bad experimental design with automated post-experiment cleanup," which should be avoided in favor of robust initial experimental design .

How do post-translational modifications affect ugpA integration and function in the membrane transport complex?

Post-translational modifications of ugpA likely play significant roles in:

  • Proper membrane insertion and topology

  • Protein-protein interactions within the ugp transport complex

  • Transport activity regulation in response to environmental conditions

  • Protein stability and turnover

Research approaches to investigate these effects would include:

  • Site-directed mutagenesis of potential modification sites

  • Proteomic analyses to identify modification patterns under different conditions

  • Structure-function studies examining the impact of modifications on transport kinetics

  • Comparative analyses between wild-type and modified proteins

While specific data on ugpA modifications is not provided in the search results, the research on the related glpT system indicates that membrane proteins in these transport systems have specific structural requirements for proper function. For instance, the glpT permease was identified as a cytoplasmic membrane protein with an apparent molecular weight of 33,000, and its overexpression affected the synthesis or assembly of other membrane proteins .

What are the methodological challenges in studying the interaction between ugpA and other components of the phosphate starvation response network?

Studying the interaction between ugpA and the broader phosphate starvation response network presents several methodological challenges:

  • Network complexity: The phosphate starvation response involves multiple regulatory pathways and gene products, requiring systems-level approaches.

  • Temporal dynamics: Capturing the timing of interactions and regulatory events requires careful experimental design and time-course analyses.

  • Pleiotropic effects: Manipulating elements of the network may cause unintended effects on other cellular processes, confounding interpretation.

  • Technical limitations: Current protein-protein interaction methodologies may disrupt membrane protein complexes or native interactions.

  • Data integration challenges: Combining data from different experimental platforms (e.g., transcriptomics, proteomics, metabolomics) requires sophisticated computational approaches.

Addressing these challenges requires thoughtful experimental design that anticipates potential confounding factors, as highlighted in the literature regarding experimental design flaws in genomic research .

What cloning strategies are most effective for expressing recombinant ugpA while maintaining protein functionality?

Based on related research approaches with the glpT system, effective cloning strategies for ugpA would include:

  • Restriction enzyme selection: Choose enzymes that preserve the complete coding sequence and important regulatory elements. For example, the glpT gene was successfully cloned using EcoRI restriction fragments .

  • Vector selection: Use vectors appropriate for membrane protein expression. The glpT gene was successfully subcloned in multicopy plasmid pACYC184, suggesting similar approaches might work for ugpA .

  • Expression control: Implement inducible promoter systems to control expression levels, as overexpression of membrane proteins can disrupt cellular functions.

  • Host selection: Choose expression hosts that can properly fold and insert membrane proteins. E. coli has been successfully used for expressing Salmonella transport proteins .

  • Fusion tag considerations: If tags are necessary, place them where they minimally interfere with protein folding and function, ideally with cleavage sites.

This approach draws on the successful cloning of glpT, where "Strains carrying this hybrid plasmid produced large amounts of cytoplasmic membrane protein with an apparent molecular weight of 33,000, which was identified as the sn-glycerol-3-phosphate permease" .

How should researchers design experiments to distinguish between the roles of ugpA and other transport systems in phosphate metabolism?

To distinguish between ugpA and other transport systems' roles in phosphate metabolism, researchers should:

  • Generate specific knockout mutants: Create single and combinatorial gene knockouts (ugpA, glpT, and other transporters) to assess individual and overlapping functions.

  • Design substrate specificity assays: Use structurally related substrates with different modifications to probe transporter preferences.

  • Implement inducible expression systems: Control the expression of individual transporters under defined conditions to assess their contribution.

  • Conduct competition assays: Perform transport studies with labeled and unlabeled substrates to determine competitive effects.

  • Employ metabolic flux analysis: Track the movement of labeled phosphate through different metabolic pathways in various mutant backgrounds.

These approaches help establish causal relationships rather than mere associations, addressing the concern that "Association studies independent of causal theories, along with multiple testing errors, too often drive health care and public policy decisions" .

What quality control measures are essential when studying recombinant ugpA to ensure experimental reproducibility?

Essential quality control measures for studying recombinant ugpA include:

  • Expression verification: Confirm protein expression through multiple methods (Western blot, mass spectrometry, activity assays).

  • Functional validation: Verify that the recombinant protein retains transport activity comparable to the native protein.

  • Membrane localization confirmation: Ensure proper insertion into the membrane using fractionation studies and localization assays.

  • Structural integrity assessment: Check that the protein maintains its expected structural properties through circular dichroism or other applicable techniques.

  • Batch consistency monitoring: Implement protocols to verify consistency between protein preparations.

  • Contamination controls: Rule out effects from co-purifying proteins or endotoxins.

These measures address the broader concern that "a whole class of post-experiment statistical methods has emerged to address confounding" rather than ensuring proper experimental design from the beginning .

How can researchers effectively analyze kinetic data from ugpA transport assays to determine meaningful functional parameters?

For effective analysis of ugpA transport kinetic data, researchers should:

  • Apply appropriate kinetic models: Use Michaelis-Menten and other relevant models to extract parameters like Km and Vmax, similar to the approach used for the glpT system where an apparent Km of 50 μM and a Vmax of 2.2 nmol/min · 10^8 cells was determined .

  • Implement statistical validation: Apply rigorous statistical tests to validate kinetic parameters and assess goodness of fit.

  • Account for membrane protein concentration: Normalize transport rates to actual protein levels in the membrane rather than total protein.

  • Consider cooperative effects: Analyze data for potential allosteric or cooperative behaviors that may not fit simple kinetic models.

  • Compare multiple experimental conditions: Analyze transport under varying pH, temperature, and ionic strength to build a comprehensive kinetic profile.

This methodical approach to kinetic analysis helps establish reliable functional parameters that can be compared across experimental conditions and between related transport systems.

What statistical approaches are most appropriate for analyzing complex datasets from ugpA regulatory network studies?

When analyzing complex datasets from ugpA regulatory network studies, the most appropriate statistical approaches include:

  • Multivariate analysis: Use principal component analysis (PCA) or factor analysis to identify patterns in high-dimensional data.

  • Network inference algorithms: Employ Bayesian networks or similar approaches to infer regulatory relationships.

  • Time-series analysis: Apply methods specifically designed for temporal data when studying dynamic responses.

  • Causal inference methods: Use directed acyclic graphs and counterfactual frameworks to establish causal relationships, similar to the "counterfactual mediation analysis" mentioned in unrelated research .

  • Multiple testing correction: Apply appropriate corrections (e.g., Bonferroni, Benjamini-Hochberg) to control false discovery rates while avoiding overly conservative approaches.

These statistical approaches should be viewed as tools to support well-designed experiments rather than remedies for poor experimental design, addressing the concern that "hypotheses are often detached from data collection, experimental design, and causal theories" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.