Recombinant Salmonella choleraesuis Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Salmonella choleraesuis Spermidine export protein MdtI (mdtI) is a protein associated with multidrug resistance in Salmonella. MdtI is the abbreviation for this protein . It is a partial recombinant protein derived from Salmonella choleraesuis strain SC-B67 . The recommended name for this protein is Spermidine export protein MdtI .

Characteristics

CharacteristicDescription
Product CodeCSB-EP688174SBF1
SourceE. coli
Purity>85% (SDS-PAGE)
Uniprot No.Q57PF4
Immunogen SpeciesSalmonella choleraesuis (strain SC-B67)
Protein LengthPartial
Storage (liquid)6 months at -20°C/-80°C
Storage (lyophilized)12 months at -20°C/-80°C
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, add 5-50% glycerol (final concentration), and aliquot for long-term storage .
Molecular FunctionTransmembrane transporter activity
Cellular ComponentPlasma membrane

Function and Role in Salmonella

MdtI is involved in the export of spermidine, a polyamine, from Salmonella choleraesuis . Polyamines are organic compounds that are essential for cell growth and proliferation. In bacteria, they are involved in various cellular processes, including DNA replication, transcription, and translation. MdtI likely functions as a transmembrane transporter, facilitating the movement of spermidine across the bacterial plasma membrane .

MdtI and Virulence

The mgtC gene mediates intramacrophage survival and proliferation within host tissues in several intracellular pathogens . Salmonella's commitment to the MgtC-dependent program requires signals promoting expression of the mgtC gene, but also that MgtC protein amounts supersede those of CigR, an anti-virulence protein that binds MgtC, thereby preventing MgtC from inhibiting the F 1F oATP synthase .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mdtI; SCH_1501; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links

KEGG: sec:SCH_1501

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtI and what is its functional role in Salmonella species?

MdtI is a spermidine export protein found in Salmonella choleraesuis (strain SC-B67) that belongs to the small multidrug resistance (SMR) family of drug exporters . Functionally, MdtI works in a complex with MdtJ (forming the MdtJI complex) to catalyze the excretion of spermidine from bacterial cells at neutral pH .

Research has demonstrated that both MdtJ and MdtI are necessary components for efficient spermidine excretion activity, as neither protein alone can sufficiently recover cells from spermidine toxicity . The MdtJI complex serves as a protective mechanism against the toxic effects of overaccumulated intracellular spermidine, helping maintain cellular homeostasis.

How does the MdtJI complex respond to spermidine accumulation?

When spermidine accumulates to toxic levels in bacterial cells, the MdtJI complex activates to excrete excess spermidine. Research has shown that spermidine itself can induce increased expression of mdtJI mRNA , suggesting a regulatory feedback mechanism where the substrate induces expression of its own exporter.

What are the optimal storage conditions for recombinant MdtI protein?

For recombinant MdtI protein, the recommended storage conditions are:

Storage TypeTemperatureDuration
Long-term storage-20°C to -80°C6-12 months
Working aliquots4°CUp to one week

The protein should be stored in an appropriate buffer such as Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Repeated freezing and thawing should be avoided as it can compromise protein integrity and function .

For lyophilized protein preparations, the shelf life is typically longer (approximately 12 months) compared to liquid preparations (approximately 6 months) .

How should researchers reconstitute and prepare recombinant MdtI for experimental use?

For optimal reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typical recommendation is 50%)

  • Aliquot for long-term storage at -20°C to -80°C to avoid repeated freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for no more than one week

When preparing for experiments, ensure that the buffer conditions are compatible with your experimental design. The protein is typically supplied in either lyophilized form or in a Tris-based buffer with glycerol .

What expression systems are commonly used for producing recombinant MdtI?

Recombinant MdtI is typically expressed in heterologous systems, with E. coli being the most common expression host . The protein can be expressed with various fusion tags to facilitate purification, with His-tags being commonly employed .

For example, recombinant full-length Salmonella choleraesuis Spermidine export protein MdtI can be produced with an N-terminal His tag in E. coli expression systems . The tag type may vary depending on the specific experimental requirements and purification strategy.

The expression region typically encompasses the full-length protein (amino acids 1-109) , although some commercial preparations may offer partial protein constructs for specific applications .

What specific amino acid residues are critical for MdtI function, and how can site-directed mutagenesis be used to investigate them?

Research has identified several critical amino acid residues in MdtI that are essential for its spermidine export function. Specifically, Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81 in MdtI have been demonstrated to be involved in the excretion activity of the MdtJI complex .

To investigate these residues:

  • Design primers for site-directed mutagenesis targeting these specific residues

  • Create single amino acid substitutions (e.g., replace charged residues with neutral ones)

  • Express and purify the mutant proteins

  • Assess functionality through:

    • Complementation assays in spermidine-sensitive strains

    • Direct measurement of [14C]spermidine excretion

    • Growth recovery experiments with high spermidine concentrations

Researchers should compare mutant proteins with wild-type MdtI to quantify the impact of each mutation on spermidine export activity. This approach can provide insights into the mechanistic aspects of substrate recognition and transport.

How does the MdtJI complex compare with other polyamine transport systems, and what methodologies can be used to investigate these differences?

The MdtJI complex differs from previously characterized polyamine transporters in E. coli (PotE and CadB) in that it functions as a spermidine exporter at neutral pH, whereas PotE and CadB primarily excrete putrescine and cadaverine at acidic pH while functioning as uptake proteins at neutral pH .

Methodologies to investigate these differences include:

  • Comparative transport assays: Measure substrate transport under varying pH conditions (acidic vs. neutral) using radiolabeled substrates.

  • Substrate specificity analysis: Compare transport rates of different polyamines (putrescine, spermidine, spermine, cadaverine) to determine specificity profiles.

  • Chimeric protein construction: Create fusion proteins combining domains from different transporters to identify regions responsible for pH sensitivity and substrate specificity.

  • Competitive inhibition studies: Use structural analogs to identify binding site characteristics.

  • Expression profiling: Analyze differential expression of transporter genes under varying environmental conditions using RT-qPCR or RNA-seq.

These comparative studies can reveal evolutionary relationships between polyamine transporters and provide insights into their specialized functions.

What is the relationship between MdtI and antimicrobial resistance mechanisms in Salmonella, and how can this be experimentally investigated?

MdtI is part of the broader network of multidrug efflux systems in Salmonella that contribute to antimicrobial resistance. While MdtI specifically functions in spermidine export, it belongs to the SMR family of drug exporters, suggesting potential roles in exporting other compounds .

To investigate the relationship between MdtI and antimicrobial resistance:

  • Gene deletion studies: Create ΔmdtI, ΔmdtJ, and ΔmdtJI knockout strains and assess susceptibility to various antimicrobials.

  • Overexpression studies: Construct strains overexpressing mdtJI and determine changes in minimum inhibitory concentrations (MICs) for different antibiotics.

  • Transcriptional analysis: Analyze expression changes of mdtJI in response to antibiotic exposure using RT-qPCR or RNA-seq.

  • Efflux assays: Measure direct efflux of fluorescent substrates (e.g., ethidium bromide, Hoechst 33342) in the presence and absence of MdtJI.

  • Resistance development studies: Compare the rate of resistance development in wild-type versus ΔmdtJI strains under selective pressure.

Research has shown that various efflux systems in Salmonella, including those in the SMR family, can contribute to virulence and drug resistance. For example, deletion of specific efflux system genes has been shown to attenuate Salmonella virulence .

How does the PhoP/PhoQ two-component system regulate MdtI expression, and what experimental approaches can elucidate this regulatory network?

The PhoP/PhoQ two-component system is a major regulator of Salmonella virulence that has been linked to the regulation of drug efflux systems . While direct regulation of mdtI by PhoP/PhoQ has not been extensively characterized in the provided search results, research has shown that this two-component system regulates other drug efflux systems, underscoring the connection between drug efflux and virulence .

To investigate potential PhoP/PhoQ regulation of MdtI:

  • Promoter analysis: Identify potential PhoP binding sites in the promoter region of mdtJI using bioinformatic approaches.

  • Reporter gene assays: Construct transcriptional fusions of the mdtJI promoter with reporter genes (e.g., lacZ, GFP) and measure expression in wild-type, ΔphoP, and ΔphoQ backgrounds.

  • Chromatin immunoprecipitation (ChIP): Determine direct binding of PhoP to the mdtJI promoter region.

  • Transcriptome analysis: Compare mdtJI expression levels in wild-type versus ΔphoP/ΔphoQ strains using RNA-seq.

  • Epistasis experiments: Analyze the phenotypic effects of mdtJI overexpression in a ΔphoP background to determine if MdtJI can complement PhoP-dependent virulence defects.

Understanding this regulatory network could provide insights into how Salmonella coordinates spermidine homeostasis with virulence and stress responses.

How can researchers design experiments to investigate the role of MdtI in Salmonella pathogenesis and host-pathogen interactions?

To investigate MdtI's role in pathogenesis:

  • Infection models:

    • Generate mdtI knockout and complemented strains

    • Compare bacterial survival in macrophage cell lines (e.g., RAW264.7, J774)

    • Assess colonization and persistence in animal models (mice)

    • Measure competitive indices between wild-type and ΔmdtI strains in mixed infections

  • Host response analysis:

    • Measure cytokine production in infected host cells

    • Analyze transcriptional responses in host cells infected with wild-type versus ΔmdtI strains

    • Assess inflammasome activation and pyroptosis induction

  • Stress resistance characterization:

    • Determine susceptibility to host-derived antimicrobial compounds

    • Measure resistance to oxidative and nitrosative stress

    • Assess survival under polyamine-limiting conditions

  • In vivo expression analysis:

    • Use in vivo expression technology (IVET) to monitor mdtI expression during infection

    • Employ dual fluorescence reporters to measure real-time gene expression in vivo

The connection between drug efflux systems and virulence has been established for other exporters in Salmonella , suggesting that MdtI might similarly contribute to pathogenesis, potentially through modulation of polyamine levels during infection.

What methodologies can be employed to investigate potential inhibitors of MdtI as antimicrobial agents?

To identify and characterize potential MdtI inhibitors:

  • High-throughput screening approaches:

    • Develop cell-based assays measuring spermidine accumulation in the presence of compound libraries

    • Use fluorescent or radiolabeled spermidine to monitor export inhibition

    • Employ growth-based screens in spermidine-sensitive strains supplemented with spermidine and potential inhibitors

  • Structure-based drug design:

    • Generate homology models of MdtI based on related crystallized transporters

    • Perform in silico docking studies to identify compounds with high binding affinity

    • Validate hits with binding assays (e.g., surface plasmon resonance, isothermal titration calorimetry)

  • Validation of hit compounds:

    • Determine minimum inhibitory concentrations (MICs) against Salmonella strains

    • Assess synergy with conventional antibiotics using checkerboard assays

    • Evaluate toxicity against mammalian cells

    • Assess efficacy in infection models

  • Resistance development studies:

    • Determine frequency of resistance emergence

    • Characterize mechanisms of resistance through whole genome sequencing of resistant mutants

Targeting MdtI or the MdtJI complex might represent a novel strategy to enhance Salmonella susceptibility to spermidine toxicity or conventional antibiotics.

How can researchers investigate the interplay between MdtI-mediated spermidine export and other polyamine homeostasis mechanisms in Salmonella?

To investigate this complex interplay:

  • Multi-gene deletion analysis:

    • Create combinations of knockout strains affecting various aspects of polyamine metabolism (biosynthesis, import, export, modification)

    • Analyze polyamine profiles using HPLC or LC-MS

    • Determine growth characteristics under various stress conditions

  • Metabolic flux analysis:

    • Use isotope-labeled polyamine precursors to track polyamine synthesis, conversion, and export

    • Quantify flux changes in response to environmental perturbations

    • Compare wild-type and mutant strains lacking specific components

  • Systems biology approaches:

    • Perform transcriptomics, proteomics, and metabolomics analyses

    • Develop computational models of polyamine homeostasis

    • Validate model predictions experimentally

  • Real-time monitoring methods:

    • Develop biosensors for intracellular polyamine concentrations

    • Use time-lapse microscopy with fluorescent reporters to track dynamic responses

The research has shown that spermidine overaccumulation can be managed through multiple mechanisms, including acetylation by spermidine acetyltransferase and neutralization by increased l-glycerol 3-phosphate . Understanding how MdtI-mediated export coordinates with these alternative mechanisms would provide insights into bacterial adaptation strategies.

What emerging technologies could advance our understanding of MdtI structure-function relationships?

Several cutting-edge technologies hold promise for deeper insights into MdtI:

  • Cryo-electron microscopy (Cryo-EM):

    • Determine high-resolution structures of the MdtJI complex

    • Visualize conformational changes during transport cycle

    • Identify binding sites for spermidine and potential inhibitors

  • Single-molecule techniques:

    • Use FRET to monitor conformational dynamics during transport

    • Apply magnetic tweezers to measure forces associated with transport

    • Perform single-molecule tracking to analyze diffusion and clustering in membranes

  • Advanced computational methods:

    • Apply molecular dynamics simulations to model transport mechanisms

    • Use machine learning to predict functional residues and substrate specificity

    • Develop quantum mechanics/molecular mechanics approaches to model substrate binding

  • Integrative structural biology:

    • Combine X-ray crystallography, NMR, and computational modeling

    • Use cross-linking mass spectrometry to identify interaction surfaces

    • Apply hydrogen-deuterium exchange mass spectrometry to assess conformational dynamics

These technologies could reveal the molecular mechanisms underlying spermidine recognition, transport, and coupling to ion gradients, potentially informing the design of specific inhibitors.

How might studying MdtI in different Salmonella serovars provide insights into its evolutionary and functional adaptations?

Comparative studies across Salmonella serovars could reveal important adaptations:

  • Genomic comparisons:

    • Analyze sequence conservation and variation in mdtI across serovars

    • Identify potential horizontal gene transfer events

    • Detect signatures of positive selection in specific lineages

  • Functional comparisons:

    • Compare spermidine export kinetics in recombinant MdtI from different serovars

    • Assess substrate specificity differences

    • Evaluate contribution to antimicrobial resistance in various serovars

  • Host-adaptation studies:

    • Investigate correlation between MdtI sequence variations and host range

    • Determine if host-specific serovars show specialized MdtI functions

    • Assess whether MdtI contributes differently to virulence in host-adapted versus generalist serovars

  • Cross-complementation experiments:

    • Test whether MdtI from one serovar can complement function in another

    • Identify critical residues that might explain functional differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.