Recombinant Salmonella choleraesuis Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

General Information

PropertyDescription
NameRecombinant Full Length Salmonella choleraesuis Spermidine export protein MdtJ(mdtJ) Protein
SynonymsmdtJ; SCH_1500; Spermidine export protein MdtJ
SpeciesSalmonella choleraesuis
SourceE. coli
Protein LengthFull Length (1-120 amino acids)
UniProt IDQ57PF5
Gene NamemdtJ
Ordered Locus NamesSCH_1500
TagHis-tagged
AA SequenceMFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI

Function and Characterization

  • Spermidine Excretion: The MdtJI protein complex is capable of excreting spermidine, suggesting it plays a crucial role in regulating intracellular spermidine levels .

  • Coexpression and Cooperation: mdtJ and mdtI are coexpressed, and both proteins are required to rescue cell viability when cells are cultured with spermidine, indicating a cooperative function .

  • E. coli Studies: Studies in E. coli have demonstrated that the MdtJI complex can catalyze the excretion of spermidine from cells, reducing the toxicity associated with spermidine overaccumulation .

  • Key Amino Acids: Specific amino acids in MdtJ (Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82) and MdtI (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) are involved in the excretion activity of MdtJI .

Role in Bacterial Pathogenesis

Salmonella is a common foodborne pathogen, and spermidine export protein MdtJ is found in Salmonella choleraesuis . Salmonella can survive for extended periods in water and refrigerated conditions, with an optimal breeding temperature of 37 °C . Recombinant Salmonella mdtJ protein is explored for vaccine development, but it cannot be used directly on humans or animals .

Production and Availability

Recombinant Salmonella choleraesuis Spermidine export protein MdtJ (mdtJ) is produced in E. coli with a His-tag . It is available as a lyophilized powder with greater than 90% purity, as determined by SDS-PAGE .

PropertyDescription
SourceE.coli
TagHis
Protein LengthFull Length (1-120)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mdtJ; SCH_1500; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function

This protein catalyzes the excretion of spermidine.

Database Links

KEGG: sec:SCH_1500

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the spermidine export protein MdtJ in Salmonella choleraesuis?

MdtJ is a membrane protein belonging to the small multidrug resistance (SMR) family of drug exporters that functions as part of a complex responsible for spermidine excretion from bacterial cells. In Salmonella choleraesuis (strain SC-B67), this protein is encoded by the mdtJ gene (also known as SCH_1500) and consists of 120 amino acids . The protein forms a functional complex with MdtI, known as the MdtJI complex, which mediates the export of spermidine across the bacterial membrane . This function is particularly important for maintaining polyamine homeostasis within bacterial cells, as overaccumulation of spermidine can be toxic and inhibit bacterial growth. The expression of mdtJI mRNA increases in the presence of spermidine, suggesting a regulatory mechanism to protect cells from polyamine toxicity .

How does the primary structure of MdtJ contribute to its function?

The MdtJ protein has a specific amino acid sequence (MFYWILLALAIATEIIGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI) that contains regions critical for membrane integration and spermidine transport . Functional studies have identified several key amino acid residues essential for the excretion activity of the MdtJI complex, including Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ . These residues likely participate in substrate recognition, binding, or the translocation pathway within the protein complex. The hydrophobic regions of MdtJ enable its integration into the bacterial membrane, while charged and polar residues may form specific interaction sites with spermidine molecules. Understanding this structure-function relationship is fundamental for researchers investigating the mechanism of polyamine export and designing experiments to modulate MdtJ activity.

What is the relationship between MdtJ and bacterial polyamine regulation?

Polyamines, including spermidine, are essential for normal bacterial cell growth and function, with their intracellular levels tightly regulated through a balance of biosynthesis, degradation, uptake, and excretion mechanisms . While several polyamine uptake systems have been well-characterized, the MdtJI complex represents one of the few identified specialized polyamine excretion systems that function at neutral pH. Unlike other transporters such as PotE and CadB, which excrete putrescine and cadaverine only at acidic pH and function as uptake proteins at neutral pH, the MdtJI complex specifically mediates spermidine excretion under physiological conditions . This function is particularly important when bacteria face high extracellular spermidine concentrations, as the MdtJI complex prevents toxic accumulation by actively exporting spermidine from the cell, thereby maintaining polyamine homeostasis.

What are optimal methods for working with recombinant MdtJ protein?

When working with recombinant MdtJ from Salmonella choleraesuis, researchers should consider several critical handling parameters. The protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for routine storage, or at -80°C for extended preservation . To maintain protein stability and activity, it's recommended to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week without significant degradation . For experimental use, particularly in functional assays, researchers should consider that MdtJ forms a complex with MdtI, and both proteins are necessary for spermidine excretion activity. Therefore, co-expression systems or reconstitution approaches that incorporate both proteins may provide more physiologically relevant results than studies examining MdtJ in isolation.

How can researchers evaluate the functional activity of the MdtJI complex?

Several experimental approaches can be used to assess MdtJ function as part of the MdtJI complex. One effective method involves using a bacterial strain deficient in spermidine acetyltransferase (an enzyme that metabolizes spermidine) to examine cell toxicity and growth inhibition due to spermidine overaccumulation . Complementation with plasmids encoding functional MdtJ and MdtI can restore cell growth, providing a clear readout of MdtJI activity. Additionally, researchers can directly measure spermidine content in cells cultured in the presence of external spermidine (e.g., 2 mM) and quantify spermidine excretion from cells expressing the MdtJI complex . Site-directed mutagenesis targeting specific amino acid residues (such as Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ) followed by functional assays can further elucidate structure-function relationships within the complex.

What analytical techniques are most effective for studying MdtJ interactions and structure?

For researchers investigating the structural basis of MdtJ function, multiple complementary approaches are recommended. Membrane protein crystallography, though challenging, could reveal the three-dimensional arrangement of the MdtJI complex. Alternative structural approaches include cryo-electron microscopy for larger assemblies or NMR spectroscopy for specific domains. Protein-protein interactions between MdtJ and MdtI can be studied using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or surface plasmon resonance. To examine substrate binding and transport mechanisms, researchers might employ isothermal titration calorimetry, fluorescence-based transport assays, or radiolabeled substrate flux measurements. Expression analysis can be conducted using quantitative PCR to monitor changes in mdtJI mRNA levels in response to varying spermidine concentrations or different environmental conditions .

How does Salmonella choleraesuis differ from other Salmonella serovars in pathogenicity?

Salmonella choleraesuis represents a host-adapted serovar with distinctive pathogenicity characteristics compared to other Salmonella enterica serovars. While most Salmonella Typhimurium infections result in only 5.7% invasive disease cases, S. choleraesuis infections demonstrate a remarkably higher invasive disease rate of 56.4% . In humans, S. choleraesuis typically causes septicemia with minimal gastrointestinal tract inflammation, resulting in a disease presentation more similar to typhoid fever . This suggests that S. choleraesuis has evolved mechanisms to evade host defenses in the gut, allowing it to disseminate systemically before the immune system can effectively contain the infection. Most human clinical cases occur in patients with pre-existing health conditions, particularly those with immunosuppressive conditions or chronic diseases, suggesting that this serovar opportunistically exploits compromised host defenses .

What potential role might MdtJ play in S. choleraesuis virulence?

While direct evidence linking MdtJ to S. choleraesuis virulence is not explicitly stated in the available research, several hypotheses can be proposed based on our understanding of polyamine metabolism and bacterial pathogenesis. Polyamines play crucial roles in bacterial stress responses, biofilm formation, and host-pathogen interactions. The MdtJI complex, by regulating intracellular spermidine levels, might contribute to S. choleraesuis adaptation during infection. For instance, the ability to efficiently export excess spermidine could help bacteria maintain optimal internal polyamine concentrations when encountering host-derived polyamines or during rapid shifts in environmental conditions. Additionally, since polyamines affect bacterial gene expression, including virulence factors, MdtJ-mediated polyamine homeostasis might indirectly influence the expression of genes critical for host invasion and immune evasion. Future research examining mdtJ expression during different stages of infection could provide valuable insights into its potential role in pathogenesis.

How can MdtJ be studied in the context of S. choleraesuis infection models?

To investigate MdtJ's role during S. choleraesuis infection, researchers should consider several complementary approaches. Gene knockout studies comparing wild-type and mdtJ-deficient strains in relevant animal models (particularly swine, the natural host) could reveal phenotypic differences in colonization, dissemination, or persistence. Transcriptomic analyses comparing mdtJ expression levels between bacteria grown in laboratory media versus those isolated from infected tissues might identify infection-specific regulation patterns. Researchers could also examine how host factors, such as antimicrobial peptides or immune cell interactions, affect mdtJ expression. For human infection studies, patient isolates might be analyzed for mdtJ sequence variations or expression levels to identify potential correlations with disease severity or clinical outcomes. These methodological approaches would require appropriate biosafety considerations given S. choleraesuis' pathogenic nature and potential for causing invasive disease.

How can recombinant attenuated S. choleraesuis vectors be utilized in vaccine development?

Recombinant attenuated Salmonella Choleraesuis strains offer significant potential as vaccine vectors due to their ability to mimic natural infections while maintaining safety. The rSC0016 vector, a well-characterized attenuated S. Choleraesuis strain, contains regulated delayed attenuation and regulated delayed exogenous synthesis systems, making it particularly suitable for vaccine development . This vector can be engineered to synthesize and secrete heterologous antigens, creating multivalent vaccine candidates. For example, researchers have successfully used rSC0016 to express and deliver Pasteurella multocida PlpE protein, demonstrating that this approach can induce protective immunity against P. multocida infection . The advantage of this system is its ability to stimulate comprehensive immune responses, including mucosal, humoral, and cellular components, which are critical for protection against many pathogens. This approach represents a promising strategy for developing vaccines against various bacterial and viral diseases affecting both humans and livestock.

What immune responses are typically induced by recombinant S. choleraesuis vaccines?

Recombinant attenuated S. Choleraesuis vaccine vectors stimulate a broad spectrum of immune responses. Studies with the rSC0016(pS-PlpE) vaccine candidate demonstrated that oral immunization induced robust antigen-specific mucosal immune responses, which are critical for protection at pathogen entry sites . Additionally, these vaccines generate strong humoral immune responses, characterized by the production of antigen-specific antibodies that can neutralize pathogens or mark them for destruction by other immune components. A particularly valuable feature of S. Choleraesuis vectors is their ability to induce mixed Th1/Th2 cellular immune responses, providing comprehensive protection through both cell-mediated and antibody-mediated mechanisms . In challenge studies, mice immunized with rSC0016(pS-PlpE) showed an 80% survival rate against lethal challenge with wild-type P. multocida, outperforming traditional inactivated vaccines (60% protection) and demonstrating significantly reduced tissue damage . These results highlight the superior immunogenicity of this vaccine delivery platform.

What methodological considerations are important when developing MdtJ-based applications?

When developing applications utilizing MdtJ or recombinant S. choleraesuis expressing modified MdtJ proteins, several methodological considerations are essential. First, researchers must carefully design expression systems that ensure proper membrane insertion and folding of MdtJ, considering its hydrophobic nature as a membrane protein. For vaccine vector applications, the stability of the mdtJ gene within the attenuated S. choleraesuis strain must be verified through multiple passages to prevent loss of expression during vaccine production or after administration . Additionally, researchers should evaluate whether MdtJ expression affects the attenuation, colonization, or immunogenic properties of the vector. For applications targeting MdtJ function itself, such as antimicrobial development, structure-based drug design approaches focusing on the critical amino acid residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) might prove fruitful . Finally, any MdtJ-based application intended for eventual clinical or veterinary use must undergo thorough safety testing, as results obtained in mouse models cannot be directly extrapolated to target species like pigs or humans .

How does the MdtJI complex compare structurally to other bacterial transport systems?

The MdtJI complex belongs to the small multidrug resistance (SMR) family of drug exporters, representing a fascinating system for comparative structural biology research . While detailed structural studies specifically on the S. choleraesuis MdtJI complex are lacking, researchers can draw insights from related transporters. A sophisticated research approach would involve comparative structural analysis between MdtJI and other SMR family members, examining conserved motifs, transmembrane domain organization, and substrate binding pockets. Critical experimental techniques would include cryo-electron microscopy, X-ray crystallography (if protein crystals can be obtained), and molecular dynamics simulations. Of particular interest would be comparing the structural basis for substrate specificity between MdtJI and other polyamine transporters, such as PotE and CadB, which function differently at varying pH levels . This research could reveal fundamental principles of polyamine transport mechanisms and potentially identify unique structural features that could be targeted for antimicrobial development.

What is the evolutionary significance of the MdtJI system across bacterial species?

Evolutionary analysis of the MdtJI system represents an advanced research direction with significant implications for understanding bacterial adaptation. Researchers should conduct comparative genomic analyses across diverse bacterial phyla to trace the evolutionary history of mdtJ and mdtI genes, examining their conservation, horizontal transfer events, and selective pressures. Of particular interest would be comparing MdtJ sequences between invasive Salmonella serovars (like S. Choleraesuis) and less invasive ones to identify potential adaptations related to pathogenicity. Studies could also explore whether environmental bacteria from polyamine-rich niches show adaptations in their MdtJ homologs. Experimental approaches might include examining MdtJ function under various evolutionary selection pressures in laboratory settings, such as gradually increasing spermidine concentrations over multiple generations to observe adaptive mutations. These evolutionary perspectives could provide insights into bacterial adaptation mechanisms and potentially reveal why certain bacterial species or strains have maintained or modified this polyamine export system throughout their evolutionary history.

What are the critical amino acid residues in MdtJ and their functional significance?

Research has identified several key amino acid residues in MdtJ that are essential for the spermidine excretion activity of the MdtJI complex. The table below summarizes these critical residues and their potential functional roles:

Amino Acid PositionResiduePotential Functional Role
4Tyrosine (Tyr)Substrate recognition/binding
5Tryptophan (Trp)Aromatic interaction with substrate
15Glutamic Acid (Glu)Ionic interaction with positively charged spermidine
45Tyrosine (Tyr)Conformational stability or substrate pathway
61Tyrosine (Tyr)Hydrogen bonding within transport channel
82Glutamic Acid (Glu)Charge interaction with substrate

These residues were identified through site-directed mutagenesis studies, where alterations to these specific amino acids significantly reduced or eliminated the spermidine excretion activity of the MdtJI complex . The presence of multiple aromatic residues (Tyr4, Trp5, Tyr45, Tyr61) suggests important roles in substrate recognition or pathway formation, while the acidic residues (Glu15, Glu82) likely interact with the positively charged spermidine molecule. This structural arrangement demonstrates sophisticated molecular recognition capabilities within this relatively small membrane protein. For researchers developing inhibitors or studying transport mechanisms, these residues represent critical targets for further investigation and potential sites for rational drug design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.