Recombinant Salmonella choleraesuis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arnC; SCH_2300; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLSKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links

KEGG: sec:SCH_2300

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ArnC in bacterial systems?

ArnC is an integral membrane glycosyltransferase that attaches a formylated form of aminoarabinose to undecaprenyl phosphate, enabling its association with the bacterial inner membrane. This modification represents a crucial step in the biosynthetic pathway that ultimately leads to Lipid A modification with aminoarabinose (L-Ara4N), conferring resistance against polymyxin antibiotics and cationic antimicrobial peptides in Gram-negative bacteria .

Methodologically, researchers have characterized ArnC function through:

  • Structural analysis using cryo-electron microscopy

  • Molecular dynamics simulations to understand substrate coordination

  • Functional assays measuring glycosyltransferase activity

  • Phenotypic assessment of polymyxin resistance in bacterial strains

How is the recombinant attenuated Salmonella Choleraesuis vector rSC0016 constructed?

The rSC0016 strain incorporates a regulated delayed attenuation system and a delayed antigen expression system. Construction involves specific genetic modifications:

  • Introduction of regulated delayed attenuation mutations that allow initial replication similar to wild-type strains followed by attenuation in host tissues

  • Deletion of the sopB gene to reduce host intestinal inflammatory responses

  • Integration of a balanced lethal system using the asd gene for plasmid maintenance without antibiotic selection

  • Incorporation of a regulated delayed antigen expression system to optimize immune responses

This vector has demonstrated stability for over 50 passages in laboratory conditions, making it suitable for heterologous antigen expression studies .

What structural features of ArnC have been elucidated through cryo-EM studies?

Cryo-electron microscopy structures of ArnC from S. enterica in both apo and nucleotide-bound conformations have revealed critical structural insights:

Structural FeatureDescriptionFunctional Significance
GT-A domainCore catalytic domain with glycosyltransferase activityContains the active site for sugar transfer
Juxtamembrane (JM) helicesConnect transmembrane domain to GT-A domainFacilitate entry of undecaprenyl phosphate (UndP) to active site
DXD motifConserved sequence in active siteFirst aspartate functions as catalytic base
Transmembrane domainAnchors protein in membraneContains lipid-binding regions
Conformational transitionClamshell-like motion upon UDP bindingBrings GT-A domain closer to JM helices

These structural features undergo significant conformational changes upon binding of the partial donor substrate, with Mn²⁺ enabling higher affinity for UDP .

What is the relationship between ArnC activity and polymyxin resistance?

ArnC catalyzes a critical step in the pathway leading to polymyxin resistance by attaching formylated aminoarabinose to undecaprenyl phosphate. This modification pathway:

  • Reduces the negative charge of bacterial outer membrane when aminoarabinose is ultimately transferred to Lipid A

  • Decreases electrostatic attraction between polymyxins and the bacterial membrane

  • Creates a physical barrier that prevents polymyxins from disrupting membrane integrity

  • Provides a mechanism for clinically significant resistance to last-resort antibiotics

Understanding this relationship has positioned ArnC as a potential target for drug design aimed at combating polymyxin resistance.

What methodological approaches are effective for expressing heterologous antigens in recombinant Salmonella Choleraesuis?

Based on successful expression studies with protective antigens like P42, P97, and PlpE, effective methodological approaches include:

MethodologyTechnical DetailsAdvantages
Balanced lethal systemUsing pYA3943 plasmid with asd gene complementationMaintains plasmid stability without antibiotics
Regulated delayed expressionArabinose-inducible araC PBAD promoterControls timing of antigen expression
Secretion systemsAddition of signal sequences for periplasmic/extracellular targetingEnhances antigen processing and presentation
Codon optimizationAdapting coding sequence to Salmonella codon usageImproves translation efficiency
Fusion protein strategiesCreating chimeric proteins with immune-enhancing domainsIncreases immunogenicity

Experimental validation shows these approaches lead to strong mucosal immunity, cell-mediated immunity, and humoral immunity with a mixed Th1/Th2-type response .

How does the proposed catalytic mechanism of ArnC function at the molecular level?

The catalytic mechanism of ArnC operates through a sophisticated coordination of substrates and conformational changes:

  • Undecaprenyl phosphate (UndP) threads between juxtamembrane helices to reach the GT-A domain

  • UndP exhibits two coordination positions within the GT-A domain:

    • P1: "standby" position for initial substrate binding

    • P2: "catalysis" position enabling nucleophilic attack

  • The first aspartate of the DXD motif functions as a catalytic base to abstract a proton from UndP

  • The activated UndP performs nucleophilic attack on the C1 carbon of the sugar donor

  • Metal ion (Mn²⁺) coordination enhances affinity for the donor substrate

This mechanism likely operates similarly across all members of the polyprenyl phosphate glycosyltransferase (Pren-P GT) family .

What immune response parameters should be measured when evaluating ArnC-expressing vaccine vectors?

Comprehensive immune response evaluation should include:

Immune ParameterMeasurement MethodSignificance
Mucosal IgAELISA of bronchoalveolar lavage fluid or intestinal washingsIndicates protective immunity at mucosal surfaces
Serum IgG titersELISA of serum samplesMeasures systemic humoral response
Cytokine profilesELISA or flow cytometry for IL-4, IFN-γ, IL-2, IL-17Determines Th1/Th2/Th17 balance
Lymphocyte proliferationMTT assay after antigen stimulationAssesses cell-mediated immune memory
Protection efficacyChallenge with virulent strain; measure survival ratesUltimate measure of vaccine effectiveness
Organ bacterial loadCFU counts in tissues after challengeIndicates clearance capacity
Histopathological assessmentTissue examination after challengeEvaluates disease severity reduction

Studies with similar recombinant vectors have shown significant improvement in survival rates (80%) compared to control groups, with reduced tissue damage and inflammatory cell infiltration .

How can molecular dynamics simulations inform inhibitor design targeting ArnC?

Molecular dynamics simulations provide crucial insights for rational inhibitor design:

  • Identification of UndP binding pathways through the juxtamembrane helices

  • Characterization of the conformational changes upon UDP binding

  • Mapping of lipid-protein interactions, particularly with cardiolipin

  • Elucidation of the two distinct coordination positions (P1 and P2) for UndP

  • Detailed understanding of catalytic residue positioning

Simulations have revealed that UndP binding is spontaneous and stable (~8 μs), while cardiolipin preferentially binds to a groove on the periplasmic transmembrane domain face with a residence time of ~0.4-0.5 μs . These insights can guide the development of compounds that disrupt substrate binding or catalytic activity.

What strategies can overcome challenges in expressing membrane proteins like ArnC in recombinant vectors?

Expression of integral membrane proteins presents unique challenges requiring specialized approaches:

ChallengeSolution StrategyImplementation Details
Protein toxicityTightly regulated expression systemsArabinose-inducible promoters with glucose repression
Membrane insertionOptimization of Shine-Dalgarno sequencesEnsures proper translation initiation and targeting
Protein foldingExpression at reduced temperaturesTypically 25-30°C instead of 37°C
Stability issuesFusion tags or modificationsAddition of stabilizing domains or removal of unstable regions
Functional verificationActivity assays in membrane fractionsTesting glycosyltransferase activity in isolated membranes
Structure preservationDetergent screening or nanodisc incorporationFor subsequent structural or functional studies

Successfully expressed membrane proteins can be verified using Western blot analysis with specific antibodies, as demonstrated with other recombinant antigens in the rSC0016 vector system .

How can ArnC-expressing Salmonella vectors be applied in antimicrobial resistance research?

ArnC-expressing vectors offer multiple research applications:

  • As tools to study immune responses against antibiotic resistance determinants

  • For delivering ArnC or its epitopes as vaccination targets to sensitize the immune system to resistant bacteria

  • In screening platforms for identifying inhibitors that block ArnC function

  • For investigating cross-protection against multiple polymyxin-resistant bacterial strains

  • As models to study the interplay between bacterial vectors and heterologous membrane protein expression

These applications could contribute to novel strategies against antimicrobial resistance, a critical global health challenge .

What optimization strategies can enhance the efficacy of recombinant Salmonella vaccines?

Based on experimental data with similar vaccine constructs, optimization strategies include:

Optimization ParameterMethodExpected Outcome
Immunization schedulePrime-boost strategies with varied intervalsEnhanced memory response
Route of administrationOral, intranasal, or combined approachesTargeted mucosal immunity
Antigen expression levelPromoter strength adjustmentOptimized antigen presentation
Vector persistenceModulation of attenuation levelsBalanced safety and immunogenicity
Adjuvant co-expressionInclusion of cytokine genesEnhanced specific immune responses
Multivalent constructsExpression of multiple antigensBroader protection spectrum

Studies with recombinant Salmonella vectors expressing P42, P97, and PlpE antigens demonstrated that these optimization strategies resulted in improved protection efficacy and reduced clinical symptoms in mouse models .

What methodological approaches are used to study ArnC substrate interactions and kinetics?

Advanced methodological approaches include:

  • Microscale Thermophoresis (MST) to measure binding affinities between ArnC and substrates

  • Coarse-grained and atomistic simulations to study substrate coordination

  • LipIDens, a pipeline for MD simulation-assisted interpretation of lipid densities in cryo-EM structures

  • Comparative analysis between datasets collected at 200 kV and 300 kV for structural resolution

  • Enzymatic assays monitoring transfer of radiolabeled or fluorescently-labeled sugars

  • Site-directed mutagenesis of proposed catalytic residues followed by activity measurements

These methods have successfully identified spontaneous and stable binding of UndP within the GT-A domain with approximately 8 μs residence time, providing crucial insights into the catalytic mechanism .

What controls should be included when evaluating recombinant Salmonella vaccine efficacy?

Robust experimental design requires appropriate controls:

Control TypeDescriptionPurpose
Empty vectorrSC0016 carrying empty plasmid (e.g., pYA3493)Controls for vector effects alone
Inactivated vaccineKilled whole-cell preparationTraditional vaccine comparison
PBS groupBuffer-only immunizationNegative control baseline
Wild-type challengeVirulent strain for challenge studiesTests protective efficacy
Non-immunized infectedInfection without prior immunizationDisease progression control
Heterologous antigenDifferent antigen in same vectorSpecificity control

These controls allow for reliable interpretation of results, as demonstrated in studies showing 80% survival in rSC0016(pS-PlpE) immunized groups compared to 60% in inactivated vaccine groups and lower rates in control groups .

How can researchers address the challenge of membrane protein purification for structural studies of ArnC?

Purification of membrane proteins like ArnC requires specialized approaches:

  • Detergent screening to identify optimal solubilization conditions

  • Incorporation into nanodiscs for cryo-EM studies, as successfully used for ArnC structural determination

  • Affinity tags placed at positions that don't interfere with protein folding or function

  • Size exclusion chromatography to ensure homogeneity

  • Stability assessment at different temperatures and pH conditions

  • Functional verification through activity assays after purification

These approaches have enabled successful structure determination of ArnC at resolutions sufficient to identify key catalytic mechanisms and conformational changes .

What statistical approaches are appropriate for analyzing immune responses to recombinant Salmonella vaccines?

Data TypeStatistical MethodApplication
Antibody titersANOVA with Tukey's post-hoc testCompare means across multiple groups
Survival ratesKaplan-Meier with log-rank testAnalyze time-to-event data
Cytokine levelsStudent's t-test or ANOVACompare means between groups
Bacterial loadsMann-Whitney U testCompare non-parametric data
Histopathological scoresKruskal-Wallis with Dunn's post-hocCompare ordinal data
Correlation analysesPearson or Spearman correlationRelate immune parameters to protection

Studies evaluating recombinant Salmonella vaccines typically require sample sizes of at least 10 animals per group to achieve statistical power of 80% at α=0.05 .

How should researchers interpret differences in protection efficacy between recombinant vector vaccines and conventional vaccines?

Interpretation requires consideration of multiple factors:

  • Route of administration differences (mucosal vs. parenteral)

  • Duration of antigen exposure (persistent expression vs. single dose)

  • Quality of immune response (balanced Th1/Th2 vs. biased response)

  • Mucosal IgA induction (typically stronger with vector vaccines)

  • Role of vector-induced innate immunity

  • Cell-mediated immune component differences

Experimental data indicates recombinant attenuated Salmonella vectors can provide superior protection (80% survival) compared to conventional inactivated vaccines (60% survival) in mouse models, likely due to enhanced mucosal and cell-mediated immunity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.