Recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA) is a protein expressed in E. coli and fused to an N-terminal His tag . The protein is associated with Salmonella choleraesuis, a bacterium known to cause disease in animals .
Key Characteristics:
The yqhA gene encodes the UPF0114 protein YqhA . The protein sequence for the full-length recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA) is :
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
| Category | Information |
|---|---|
| Gene Name | yqhA |
| Synonyms | yqhA; SCH_3095; UPF0114 protein YqhA |
| Ordered Locus Names | SCH_3095 |
| UniProt ID | Q57JW1 |
| Amino Acid Sequence | MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH |
Recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA) is used in various research applications, including:
ELISA Assays: The protein can be used in ELISA (Enzyme-Linked Immunosorbent Assay) for detecting and quantifying antibodies against Salmonella choleraesuis .
Vaccine Development: Recombinant attenuated Salmonella strains, including S. Choleraesuis, are used as vaccine vectors to deliver heterologous antigens and induce immune responses .
Immunogenicity Studies: The protein can be utilized to assess the immunogenicity of Salmonella vaccines in vivo, evaluating humoral, mucosal, and cellular immune responses .
KEGG: sec:SCH_3095
For optimal preservation of recombinant YqhA protein activity, the following evidence-based storage protocols are recommended:
| Storage Parameter | Recommended Condition | Notes |
|---|---|---|
| Short-term storage | 4°C | Maintain for up to one week only |
| Regular storage | -20°C | In Tris-based buffer with 50% glycerol |
| Long-term storage | -80°C | For extended preservation |
| Buffer composition | Tris-based with 50% glycerol | Optimized specifically for YqhA stability |
| Freeze-thaw cycles | Minimize | Repeated freezing and thawing is not recommended |
The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein . When working with this protein, prepare working aliquots to minimize freeze-thaw cycles that can degrade protein structure and function .
To elucidate the function of YqhA in S. choleraesuis, researchers should consider a multi-faceted approach:
Gene deletion studies: Creating yqhA knockout mutants using homologous recombination or CRISPR-Cas9 systems to assess phenotypic changes, particularly in membrane integrity and antimicrobial resistance.
Protein localization: Employing immunofluorescence microscopy or fractionation studies to confirm the membrane localization of YqhA, which is predicted based on its sequence characteristics .
Protein-protein interaction studies: Using pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation to identify protein partners that interact with YqhA, which may indicate its functional pathways.
Structural analysis: Applying X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of YqhA, which could provide insight into its function based on structural homology with characterized proteins.
Transcriptional analysis: Employing RNA-seq or qPCR to identify conditions that regulate yqhA expression, particularly during host infection or antimicrobial exposure, similar to studies performed with other membrane proteins in Salmonella .
Engineering recombinant S. choleraesuis as vaccine vectors involves several methodological considerations:
Attenuation strategies: Multiple approaches have been developed, including regulated delayed attenuation systems (RDAS) as seen in strains like rSC0011 (ΔP crp527::TT araC P BAD crp Δpmi-2426 ΔrelA199::araC P BAD lacI TT ΔasdA33) and rSC0012 (ΔP fur88::TT araC P BAD fur Δpmi-2426 ΔrelA199::araC P BAD lacI TT ΔasdA33) .
Balanced lethal systems: These employ complementation of genes like asd (aspartate semialdehyde dehydrogenase) to ensure plasmid stability and continuous heterologous antigen expression .
Heterologous antigen delivery: The recombinant S. choleraesuis can be engineered to express and deliver foreign antigens from various pathogens, as demonstrated with proteins like SaoA from S. suis, P42 and P97 from M. hyopneumoniae, and PlpE from P. multocida .
YqhA's potential role in vaccine development remains largely unexplored, but as a membrane protein, it could:
Serve as a carrier for heterologous epitopes
Function as an adjuvant to enhance immune responses
Act as a target for attenuating mutations if it plays a role in virulence
Researchers have found that different attenuated S. choleraesuis strains vary in their ability to induce immune responses. For example, strain rSC0012 with the regulated delayed fur mutation induced less inflammatory cytopathology than strain rSC0011 with the regulated delayed crp mutation, while still maintaining strong immunogenicity .
Recombinant attenuated S. choleraesuis vaccines induce comprehensive immune responses that can be categorized and measured as follows:
Studies have demonstrated that oral inoculation with recombinant S. choleraesuis strains such as rSC0016 expressing heterologous antigens results in strong mucosal immunity, cell-mediated immunity, and humoral immunity, characterized by a mixed Th1/Th2-type response . For example, mice immunized with rSC0016(pS-PlpE) showed increased levels of specific IL-4 and IFN-γ and enhanced proliferation of lymphocytes, confirming a robust cellular immune response .
The protective efficacy is typically assessed through challenge studies, where immunized animals are exposed to virulent strains of the target pathogen. Parameters measured include survival rates, weight loss, clinical symptoms, and histopathological examination of affected tissues .
Developing effective live attenuated S. choleraesuis vaccines presents several technical challenges that researchers must address methodically:
Attenuation-immunogenicity balance: Excessive attenuation reduces colonization and antigen delivery, while insufficient attenuation raises safety concerns. Research has shown that "some live attenuated Salmonella vaccine vectors have been insufficiently attenuated, whereas others were over-attenuated but insufficiently immunogenic" .
Regulated delayed attenuation systems (RDAS): These systems allow bacteria to establish initial infection before attenuation occurs. For example, comparing strains with different regulated delayed mutations:
Plasmid stability: Maintaining stable expression of heterologous antigens requires balanced lethal systems. Studies have demonstrated that using asd complementation allows plasmid retention for over 50 passages in recombinant strains .
Heterologous antigen expression burden: Foreign antigen expression can reduce bacterial fitness and growth capacity. For instance, growth curve analysis revealed that "rSC0016(pS-PlpE) grew somewhat slower than the rSC0016(pYA3493) between 6 and 8 h," indicating that "foreign antigen expression may influence the growth capacity of the rSC0016 vector" .
Route of administration: Oral vaccination requires sufficient survival through gastric passage, while other routes may have different attenuation requirements. Studies show that the route affects "the generation of immune types" with different profiles of Th1/Th2 responses .
The AcrAB-TolC system represents a critical efflux mechanism contributing to antimicrobial resistance in Salmonella species. Key findings include:
Activation mechanisms: Research has demonstrated that "increased levels of both ramA and soxS expression were demonstrated by some field isolates of S. Choleraesuis upon activation of the AcrAB-TolC system" .
Fluoroquinolone resistance: "Activation of the AcrAB efflux pump is responsible for the emergence of fluoroquinolone-resistant Salmonella strains" .
Substrate influence: Different antimicrobial classes may variably affect acrB expression. Studies suggest that "the antimicrobial class used as first-line drugs may be associated with the frequency of fluoroquinolone resistance in bacterial strains" .
Interact with components of the AcrAB-TolC efflux system
Contribute to membrane permeability and thus indirectly affect drug efflux
Participate in stress responses related to antimicrobial exposure
Methodologically, researchers investigating this connection should consider protein interaction studies, co-expression analysis, and phenotypic studies of yqhA deletion mutants under antimicrobial stress conditions.
Several cutting-edge technologies hold promise for elucidating the function of UPF0114 family proteins like YqhA:
CRISPR interference (CRISPRi): Allows for tunable repression of gene expression without modifying the genome, enabling precise temporal control of yqhA expression during different growth phases or infection stages.
Proximity-dependent biotin identification (BioID): This technique can identify proteins that interact with YqhA even transiently or under specific conditions, potentially revealing functional networks.
Cryo-electron tomography: Enables visualization of protein complexes in their native cellular environment at near-atomic resolution, useful for membrane proteins like YqhA that are challenging to study with traditional structural biology methods.
High-throughput phenotypic screening: Using transposon insertion sequencing (TIS) methods like TraDIS or Tn-seq to identify genetic interactions with yqhA under various stress conditions or in infection models.
Single-cell RNA sequencing of infected host cells: Can reveal how yqhA expression correlates with different bacterial subpopulations during infection, potentially linking it to specific virulence states.
These technologies, combined with traditional approaches, could help transition YqhA from an "uncharacterized protein family" (UPF) to a protein with well-defined function in bacterial physiology or pathogenesis.
Future directions in recombinant S. choleraesuis vaccine vector development include:
Multi-antigen delivery systems: Engineering vectors capable of simultaneously expressing multiple protective antigens from different pathogens to create polyvalent vaccines. Current research has already demonstrated success with individual antigens like SaoA, PlpE, P42, and P97 .
Tissue-specific antigen expression: Developing promoter systems that activate heterologous antigen expression only in specific host tissues to optimize immune responses at relevant sites.
Advanced attenuation strategies: Research indicates that regulated delayed attenuation systems can be further refined by selecting optimal gene targets. Studies comparing fur and crp regulated mutations found that "strain with regulated delayed fur mutation may stimulate stronger antibody response with fewer bacteria than strain with regulated delayed crp mutation" .
Tailored immune response modulation: Incorporating genes encoding cytokines or immune modulators to skew immune responses toward desired Th1/Th2 balances for specific pathogens.
Biocontainment mechanisms: Implementing advanced genetic safeguards to prevent environmental spread, such as essential gene complementation systems that function only within the host.
Host-specific optimization: Current research acknowledges that "outcomes observed in mice cannot be extrapolated to pigs," highlighting the need for host-specific vector optimization for veterinary applications .
These advanced approaches could address current limitations and expand the utility of S. choleraesuis vaccine vectors for both veterinary and potentially human applications.