Recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella choleraesuis UPF0114 Protein YqhA (yqhA)

Recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA) is a protein expressed in E. coli and fused to an N-terminal His tag . The protein is associated with Salmonella choleraesuis, a bacterium known to cause disease in animals .

Key Characteristics:

  • Source: Salmonella choleraesuis

  • Expression Host: E. coli

  • Tag: His tag (N-terminal)

  • Protein Length: Full Length (1-164 amino acids)

  • Synonyms: yqhA; SCH_3095; UPF0114 protein YqhA

  • UniProt ID: Q57JW1

Gene and Protein Information

The yqhA gene encodes the UPF0114 protein YqhA . The protein sequence for the full-length recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA) is :

MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH

Table 1: Gene and Protein Details

CategoryInformation
Gene NameyqhA
SynonymsyqhA; SCH_3095; UPF0114 protein YqhA
Ordered Locus NamesSCH_3095
UniProt IDQ57JW1
Amino Acid SequenceMERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH

Applications in Research

Recombinant Salmonella choleraesuis UPF0114 protein YqhA (yqhA) is used in various research applications, including:

  1. ELISA Assays: The protein can be used in ELISA (Enzyme-Linked Immunosorbent Assay) for detecting and quantifying antibodies against Salmonella choleraesuis .

  2. Vaccine Development: Recombinant attenuated Salmonella strains, including S. Choleraesuis, are used as vaccine vectors to deliver heterologous antigens and induce immune responses .

  3. Immunogenicity Studies: The protein can be utilized to assess the immunogenicity of Salmonella vaccines in vivo, evaluating humoral, mucosal, and cellular immune responses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
yqhA; SCH_3095; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_3095

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and handling protocols for recombinant YqhA protein in laboratory settings?

For optimal preservation of recombinant YqhA protein activity, the following evidence-based storage protocols are recommended:

Storage ParameterRecommended ConditionNotes
Short-term storage4°CMaintain for up to one week only
Regular storage-20°CIn Tris-based buffer with 50% glycerol
Long-term storage-80°CFor extended preservation
Buffer compositionTris-based with 50% glycerolOptimized specifically for YqhA stability
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended

The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein . When working with this protein, prepare working aliquots to minimize freeze-thaw cycles that can degrade protein structure and function .

What methodological approaches are recommended for studying the function of YqhA in S. choleraesuis?

To elucidate the function of YqhA in S. choleraesuis, researchers should consider a multi-faceted approach:

  • Gene deletion studies: Creating yqhA knockout mutants using homologous recombination or CRISPR-Cas9 systems to assess phenotypic changes, particularly in membrane integrity and antimicrobial resistance.

  • Protein localization: Employing immunofluorescence microscopy or fractionation studies to confirm the membrane localization of YqhA, which is predicted based on its sequence characteristics .

  • Protein-protein interaction studies: Using pull-down assays, bacterial two-hybrid systems, or co-immunoprecipitation to identify protein partners that interact with YqhA, which may indicate its functional pathways.

  • Structural analysis: Applying X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of YqhA, which could provide insight into its function based on structural homology with characterized proteins.

  • Transcriptional analysis: Employing RNA-seq or qPCR to identify conditions that regulate yqhA expression, particularly during host infection or antimicrobial exposure, similar to studies performed with other membrane proteins in Salmonella .

How can recombinant S. choleraesuis strains be engineered as vaccine vectors, and what role might YqhA play?

Engineering recombinant S. choleraesuis as vaccine vectors involves several methodological considerations:

  • Attenuation strategies: Multiple approaches have been developed, including regulated delayed attenuation systems (RDAS) as seen in strains like rSC0011 (ΔP crp527::TT araC P BAD crp Δpmi-2426 ΔrelA199::araC P BAD lacI TT ΔasdA33) and rSC0012 (ΔP fur88::TT araC P BAD fur Δpmi-2426 ΔrelA199::araC P BAD lacI TT ΔasdA33) .

  • Balanced lethal systems: These employ complementation of genes like asd (aspartate semialdehyde dehydrogenase) to ensure plasmid stability and continuous heterologous antigen expression .

  • Heterologous antigen delivery: The recombinant S. choleraesuis can be engineered to express and deliver foreign antigens from various pathogens, as demonstrated with proteins like SaoA from S. suis, P42 and P97 from M. hyopneumoniae, and PlpE from P. multocida .

YqhA's potential role in vaccine development remains largely unexplored, but as a membrane protein, it could:

  • Serve as a carrier for heterologous epitopes

  • Function as an adjuvant to enhance immune responses

  • Act as a target for attenuating mutations if it plays a role in virulence

Researchers have found that different attenuated S. choleraesuis strains vary in their ability to induce immune responses. For example, strain rSC0012 with the regulated delayed fur mutation induced less inflammatory cytopathology than strain rSC0011 with the regulated delayed crp mutation, while still maintaining strong immunogenicity .

What types of immune responses are induced by recombinant attenuated S. choleraesuis vaccines and how are they measured?

Recombinant attenuated S. choleraesuis vaccines induce comprehensive immune responses that can be categorized and measured as follows:

Immune Response TypeMeasurement MethodsObservations in Studies
Humoral immunityELISA for IgG in serumHigh titers of antigen-specific antibodies
Mucosal immunityELISA for IgA in mucosal washesSignificant secretory IgA in vaginal, intestinal washes
Cell-mediated immunityELISPOT for IFN-γ and IL-4Mixed Th1/Th2 responses with elevated cytokine levels
T-cell phenotypingFlow cytometry for CD4+/CD8+ T cellsIncreased T-cell proliferation after stimulation
Isotype profilingELISA for IgG1 (Th2) and IgG2a (Th1)Both isotypes present, indicating balanced response

Studies have demonstrated that oral inoculation with recombinant S. choleraesuis strains such as rSC0016 expressing heterologous antigens results in strong mucosal immunity, cell-mediated immunity, and humoral immunity, characterized by a mixed Th1/Th2-type response . For example, mice immunized with rSC0016(pS-PlpE) showed increased levels of specific IL-4 and IFN-γ and enhanced proliferation of lymphocytes, confirming a robust cellular immune response .

The protective efficacy is typically assessed through challenge studies, where immunized animals are exposed to virulent strains of the target pathogen. Parameters measured include survival rates, weight loss, clinical symptoms, and histopathological examination of affected tissues .

What are the technical challenges in balancing attenuation and immunogenicity in S. choleraesuis vaccine vectors?

Developing effective live attenuated S. choleraesuis vaccines presents several technical challenges that researchers must address methodically:

  • Attenuation-immunogenicity balance: Excessive attenuation reduces colonization and antigen delivery, while insufficient attenuation raises safety concerns. Research has shown that "some live attenuated Salmonella vaccine vectors have been insufficiently attenuated, whereas others were over-attenuated but insufficiently immunogenic" .

  • Regulated delayed attenuation systems (RDAS): These systems allow bacteria to establish initial infection before attenuation occurs. For example, comparing strains with different regulated delayed mutations:

    • rSC0011 with ΔP crp527::TT araC P BAD crp mutation showed higher colonization but caused occasional morbidity

    • rSC0012 with ΔP fur88::TT araC P BAD fur mutation showed reduced inflammatory cytokine production and better safety profile while maintaining immunogenicity

  • Plasmid stability: Maintaining stable expression of heterologous antigens requires balanced lethal systems. Studies have demonstrated that using asd complementation allows plasmid retention for over 50 passages in recombinant strains .

  • Heterologous antigen expression burden: Foreign antigen expression can reduce bacterial fitness and growth capacity. For instance, growth curve analysis revealed that "rSC0016(pS-PlpE) grew somewhat slower than the rSC0016(pYA3493) between 6 and 8 h," indicating that "foreign antigen expression may influence the growth capacity of the rSC0016 vector" .

  • Route of administration: Oral vaccination requires sufficient survival through gastric passage, while other routes may have different attenuation requirements. Studies show that the route affects "the generation of immune types" with different profiles of Th1/Th2 responses .

How does the AcrAB-TolC system relate to antimicrobial resistance in S. choleraesuis, and could YqhA be involved?

The AcrAB-TolC system represents a critical efflux mechanism contributing to antimicrobial resistance in Salmonella species. Key findings include:

  • Activation mechanisms: Research has demonstrated that "increased levels of both ramA and soxS expression were demonstrated by some field isolates of S. Choleraesuis upon activation of the AcrAB-TolC system" .

  • Fluoroquinolone resistance: "Activation of the AcrAB efflux pump is responsible for the emergence of fluoroquinolone-resistant Salmonella strains" .

  • Substrate influence: Different antimicrobial classes may variably affect acrB expression. Studies suggest that "the antimicrobial class used as first-line drugs may be associated with the frequency of fluoroquinolone resistance in bacterial strains" .

  • Interact with components of the AcrAB-TolC efflux system

  • Contribute to membrane permeability and thus indirectly affect drug efflux

  • Participate in stress responses related to antimicrobial exposure

Methodologically, researchers investigating this connection should consider protein interaction studies, co-expression analysis, and phenotypic studies of yqhA deletion mutants under antimicrobial stress conditions.

What emerging technologies might advance our understanding of UPF0114 protein function in bacterial systems?

Several cutting-edge technologies hold promise for elucidating the function of UPF0114 family proteins like YqhA:

  • CRISPR interference (CRISPRi): Allows for tunable repression of gene expression without modifying the genome, enabling precise temporal control of yqhA expression during different growth phases or infection stages.

  • Proximity-dependent biotin identification (BioID): This technique can identify proteins that interact with YqhA even transiently or under specific conditions, potentially revealing functional networks.

  • Cryo-electron tomography: Enables visualization of protein complexes in their native cellular environment at near-atomic resolution, useful for membrane proteins like YqhA that are challenging to study with traditional structural biology methods.

  • High-throughput phenotypic screening: Using transposon insertion sequencing (TIS) methods like TraDIS or Tn-seq to identify genetic interactions with yqhA under various stress conditions or in infection models.

  • Single-cell RNA sequencing of infected host cells: Can reveal how yqhA expression correlates with different bacterial subpopulations during infection, potentially linking it to specific virulence states.

These technologies, combined with traditional approaches, could help transition YqhA from an "uncharacterized protein family" (UPF) to a protein with well-defined function in bacterial physiology or pathogenesis.

How might engineering of recombinant S. choleraesuis vaccine vectors evolve to improve vaccine efficacy and safety?

Future directions in recombinant S. choleraesuis vaccine vector development include:

  • Multi-antigen delivery systems: Engineering vectors capable of simultaneously expressing multiple protective antigens from different pathogens to create polyvalent vaccines. Current research has already demonstrated success with individual antigens like SaoA, PlpE, P42, and P97 .

  • Tissue-specific antigen expression: Developing promoter systems that activate heterologous antigen expression only in specific host tissues to optimize immune responses at relevant sites.

  • Advanced attenuation strategies: Research indicates that regulated delayed attenuation systems can be further refined by selecting optimal gene targets. Studies comparing fur and crp regulated mutations found that "strain with regulated delayed fur mutation may stimulate stronger antibody response with fewer bacteria than strain with regulated delayed crp mutation" .

  • Tailored immune response modulation: Incorporating genes encoding cytokines or immune modulators to skew immune responses toward desired Th1/Th2 balances for specific pathogens.

  • Biocontainment mechanisms: Implementing advanced genetic safeguards to prevent environmental spread, such as essential gene complementation systems that function only within the host.

  • Host-specific optimization: Current research acknowledges that "outcomes observed in mice cannot be extrapolated to pigs," highlighting the need for host-specific vector optimization for veterinary applications .

These advanced approaches could address current limitations and expand the utility of S. choleraesuis vaccine vectors for both veterinary and potentially human applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.