Recombinant Salmonella choleraesuis UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella choleraesuis UPF0208 Membrane Protein YfbV (yfbV)

Salmonella choleraesuis UPF0208 membrane protein YfbV (yfbV) is a protein that belongs to the UPF0208 family and is found in Salmonella choleraesuis . It is sometimes referred to as YfbV or SCH_2337 and is a membrane protein with unknown function . The YfbV protein is encoded by the yfbV gene .

Characteristics of Recombinant Salmonella choleraesuis UPF0208 Membrane Protein YfbV (yfbV)

CharacteristicDescription
NameRecombinant Full Length Salmonella choleraesuis UPF0208 membrane protein YfbV(Yfbv) Protein, His-Tagged
SourceE. coli
TagHis
Protein LengthFull Length (1-151)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
AA SequenceMSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQALAPVEGKPDYQALADTLKRAFKQLDKTFLDDL
Gene NameyfbV
SynonymsyfbV; SCH_2337; UPF0208 membrane protein YfbV
UniProt IDQ57M19
Expression Region1-151
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles . Store working aliquots at 4°C for up to one week .
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .

Function and Significance

The precise function of YfbV in Salmonella choleraesuis is not well-defined, but research suggests potential roles in bacterial physiology and pathogenesis. Studies on related proteins, such as YfdX in Salmonella Typhi, indicate involvement in antibiotic susceptibility and virulence . Similarly, YqiC in Salmonella enterica serovar Typhimurium, which shares structural similarities with YfbV, is crucial for mice colonization and pathogen-host interaction . Furthermore, Salmonella Choleraesuis outer membrane vesicles contain YfbV, suggesting its role in immune responses and pathogenicity .

Research Findings

  • Role in Antibiotic Susceptibility and Virulence: YfdX, a protein similar to YfbV, influences Salmonella's susceptibility to antibiotics and modulates bacterial virulence . Deficiency of YfdX enhances Salmonella virulence, indicating its role in the bacteria's survival strategies .

  • Membrane Fusogenic Activity: YqiC, another related protein, exhibits membrane fusogenic activity, suggesting its involvement in membrane fusion events during bacterial infection . This activity may be crucial for Salmonella's interaction with host cells and hijacking membrane trafficking pathways .

  • Immune Response and Pathogenicity: YfbV is found in outer membrane vesicles of Salmonella Choleraesuis, indicating its potential role in stimulating immune responses . These vesicles elicit strong humoral and mucosal immune responses, contributing to the bacteria's pathogenicity .

  • Serum Resistance: PagC, an outer-membrane protein in Salmonella enterica serovar Choleraesuis, is required for serum resistance, a crucial virulence factor . Mutation in pagC results in decreased resistance to complement-mediated killing, highlighting its importance in systemic infections .

  • FraB Deglycase Mechanism: Research on FraB, a deglycase in Salmonella, reveals insights into its catalytic mechanism, providing a foundation for designing small-molecule inhibitors . Understanding these mechanisms is vital for developing Salmonella-specific antibacterials .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we prioritize developing your specified tag type if provided.
Synonyms
yfbV; SCH_2337; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_2337

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0208 membrane protein YfbV and what is its significance in Salmonella research?

YfbV (yfbV gene product) is a membrane protein belonging to the UPF0208 family found in Salmonella choleraesuis. The protein consists of 151 amino acids and is expressed on the bacterial membrane. The UPF (Uncharacterized Protein Family) designation indicates that while the protein has been identified and sequenced, its precise biological function remains incompletely characterized in scientific literature .

The significance of YfbV lies in understanding Salmonella choleraesuis pathogenicity, as this serotype has a high predilection for causing systemic infections in humans, particularly bacteremia that can lead to dangerous complications such as mycotic aneurysm . Research on membrane proteins like YfbV may provide insights into bacterial survival mechanisms, virulence factors, and potential targets for vaccine development or antimicrobial strategies against this pathogen.

How does YfbV compare with other membrane proteins in Salmonella species?

YfbV belongs to the broader category of membrane proteins in Salmonella species, but it has distinct characteristics compared to better-studied membrane components like O-antigens or lipopolysaccharides (LPS). Unlike the O-antigen gene clusters that have been extensively characterized for their role in serotype classification and virulence , YfbV's specific function and contribution to bacterial physiology remain less defined.

While O-antigens are part of the LPS on the outer bacterial membrane and directly interact with host immune systems, YfbV may play more subtle roles in membrane integrity, transport functions, or signaling pathways. In the context of Salmonella research, O-antigens have received substantial attention because they determine serotype specificity and are targets for vaccine development , whereas proteins like YfbV represent a frontier for discovering novel functions and potential intervention targets.

What are the recommended expression systems and purification strategies for recombinant YfbV?

Based on current recombinant protein production protocols, E. coli is the preferred expression system for recombinant Salmonella choleraesuis YfbV protein . The protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography. This approach allows for efficient isolation of the target protein from the complex bacterial lysate.

The purification workflow generally includes:

  • Bacterial cell lysis under conditions that maintain protein stability

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Size exclusion chromatography for further purification if needed

  • Quality control by SDS-PAGE, with expected purity greater than 90%

For membrane proteins like YfbV, special consideration should be given to the solubilization step, which may require detergents or other membrane-disrupting agents to efficiently extract the protein from the bacterial membrane while maintaining its native conformation.

What are the optimal storage conditions and reconstitution protocols for maintaining YfbV stability?

For optimal stability, recombinant YfbV protein should be stored as follows:

  • Long-term storage: The lyophilized powder form should be stored at -20°C to -80°C .

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 provides stability for the lyophilized form .

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 50% for cryoprotection.

  • Aliquot for long-term storage to avoid repeated freeze-thaw cycles .

These conditions help maintain protein integrity and biological activity. Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of function.

What analytical methods are most effective for characterizing YfbV structure and function?

For comprehensive characterization of recombinant YfbV protein, researchers should employ several complementary analytical approaches:

  • Structural Analysis:

    • SDS-PAGE for purity assessment and molecular weight confirmation

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Mass spectrometry for precise molecular weight determination and post-translational modifications

    • Protein crystallography or cryo-EM for three-dimensional structure (though challenging for membrane proteins)

  • Functional Analysis:

    • Membrane insertion assays to confirm proper localization

    • Protein-protein interaction studies using pull-down assays or crosslinking

    • Site-directed mutagenesis to identify functional residues

    • Liposome reconstitution to study membrane-associated functions

  • Immunological Methods:

    • Western immunoblotting using anti-His tag antibodies or specific anti-YfbV antibodies

    • ELISA to quantify protein and study interactions with potential binding partners

These methods provide complementary information about the structural integrity and potential functional roles of YfbV in Salmonella biology.

How can YfbV be utilized in vaccine development strategies against Salmonella infections?

While YfbV itself has not been directly identified as a primary vaccine antigen candidate in the provided search results, the protein could be integrated into vaccine development strategies in several ways:

  • As a carrier protein: YfbV could potentially serve as a carrier for presenting Salmonella-specific epitopes to the immune system, similar to how other bacterial proteins are used in conjugate vaccines.

  • Component in attenuated live vaccines: The research on recombinant attenuated Salmonella Typhimurium expressing heterologous O-antigens demonstrates a strategy where bacterial components are expressed in attenuated strains. Similar approaches could incorporate YfbV expression in vaccine development.

  • Target for comprehensive protection: Studies have shown that immunization with recombinant attenuated Salmonella Typhimurium expressing heterologous O-antigens from Salmonella Choleraesuis provided both homologous and heterologous protection in mouse models . Similar approaches targeting membrane proteins like YfbV might enhance comprehensive protection.

Current experimental evidence demonstrates that vaccine candidates like SLT17 (pCZ1) and SLT18 (pCZ1) induced specific IgG against heterologous O-antigens, providing protection against homologous challenges and partial protection (83% and 50% respectively) against heterologous Salmonella Choleraesuis challenges . This suggests that targeting multiple membrane components could improve vaccine efficacy.

What is the potential role of YfbV in Salmonella choleraesuis pathogenesis?

While the specific role of YfbV in pathogenesis is not directly elucidated in the search results, we can infer potential functions based on the context of Salmonella choleraesuis infection biology:

Salmonella choleraesuis is highly pathogenic to humans, causing septicemic disease with minimal intestinal involvement . As a membrane protein, YfbV may contribute to:

  • Membrane integrity and survival: Membrane proteins often maintain structural integrity, which is essential for bacterial survival in host environments.

  • Virulence mechanisms: Many membrane proteins in pathogenic bacteria facilitate adherence, invasion, or evasion of host immune responses.

  • Adaptation to host environments: Membrane proteins can sense environmental changes and trigger adaptive responses, potentially contributing to the serotype's ability to cause systemic infections.

It's notable that Salmonella choleraesuis shows the highest predilection among nontyphoid Salmonella serotypes to cause systemic infections in humans . The emergence of antibiotic-resistant strains further complicates treatment options, highlighting the importance of understanding membrane proteins like YfbV that might be involved in pathogenesis or resistance mechanisms.

How does YfbV expression compare between different growth conditions and infection stages?

While the search results don't provide specific data on YfbV expression under different conditions, general principles of bacterial membrane protein regulation suggest that YfbV expression may vary according to:

  • Growth phase: Expression might be differentially regulated during logarithmic growth versus stationary phase, reflecting changing metabolic needs.

  • Environmental stressors: Conditions such as low pH, antimicrobial presence, or nutrient limitation might alter YfbV expression as part of adaptive responses.

  • Host interaction stages: Expression could change during different infection stages (adhesion, invasion, intracellular survival, dissemination).

To properly characterize these expression patterns, researchers should consider:

  • Quantitative RT-PCR to measure yfbV gene expression under various conditions

  • Western blot analysis with anti-YfbV antibodies to quantify protein levels

  • Reporter gene fusions (e.g., yfbV-GFP) to monitor expression in real-time

  • Proteomic approaches to analyze membrane protein composition holistically

Understanding these expression patterns could provide insights into YfbV's functional significance and potential as a therapeutic target.

What structural modifications of YfbV might enhance its utility in immunological studies?

For researchers seeking to utilize YfbV in immunological studies, several structural modifications could be considered:

  • Tag optimization: While the current N-terminal His-tag facilitates purification , alternative tag positions or types (such as FLAG, GST, or SUMO) might improve protein solubility or presentation of native epitopes.

  • Domain-specific expression: Expressing specific domains of YfbV, particularly those predicted to be surface-exposed, might enhance immunogenicity or facilitate study of domain-specific functions.

  • Site-directed mutagenesis: Modifying specific amino acid residues, particularly those in predicted functional regions, could elucidate structure-function relationships and potentially enhance immunogenicity.

  • Chimeric constructs: Creating fusion proteins that combine YfbV with known immunomodulatory domains or epitopes from other Salmonella antigens might enhance immune responses, similar to the approach used with O-antigen expression in vaccine development .

Experimental evidence from related studies shows that expressing heterologous antigens in attenuated Salmonella strains can induce specific IgG responses and provide protection against bacterial challenges . Similar approaches might be applied to optimize YfbV-based immunological studies.

How might YfbV interact with host immune components during Salmonella choleraesuis infection?

Understanding YfbV interactions with host immune components requires sophisticated experimental approaches:

  • Pattern recognition receptor (PRR) interaction studies: Investigating whether YfbV is recognized by specific host PRRs such as Toll-like receptors (TLRs) or NOD-like receptors (NLRs).

  • Immunoprecipitation and pull-down assays: Identifying host proteins that directly interact with YfbV during infection.

  • Cytokine profiling: Measuring cytokine responses in immune cells exposed to purified YfbV or comparing responses between wild-type and yfbV-deficient Salmonella strains.

  • T-cell epitope mapping: Identifying specific regions of YfbV that might be presented to T-cells via MHC molecules.

These studies would be particularly relevant given that Salmonella choleraesuis causes systemic infections with possible serious complications like mycotic aneurysm . The specific interactions between bacterial membrane components and host immunity could influence disease progression and outcomes.

What are the comparative genetic and functional differences of yfbV among different Salmonella serotypes?

Comparative analysis of yfbV across Salmonella serotypes could provide valuable insights into evolutionary adaptations and serotype-specific pathogenicity:

  • Sequence homology analysis: Comparing yfbV sequences across Salmonella serotypes to identify conserved and variable regions that might correlate with serotype-specific virulence patterns.

  • Expression level comparison: Quantifying yfbV expression in different serotypes (e.g., Salmonella Choleraesuis vs. Salmonella Typhimurium) under standardized conditions.

  • Functional complementation studies: Expressing yfbV from different serotypes in a common genetic background to assess functional differences.

  • Host-specific adaptation analysis: Investigating whether yfbV variations correlate with host adaptation patterns (e.g., broad-host-range serotypes vs. host-adapted serotypes like Choleraesuis).

This research direction is particularly relevant considering the epidemiological differences in Salmonella Choleraesuis prevalence between regions. While it has decreased in the United States (from approximately 80 cases annually in 1990-1996 to 15 cases in 2000), it remains a significant concern in Asian countries like Taiwan, where it ranked second among common Salmonella serotypes isolated from humans . These geographical differences might relate to genetic variations in virulence factors, including membrane proteins like YfbV.

What gene knockout or silencing strategies are most effective for studying yfbV function?

For researchers investigating the functional significance of yfbV, several gene modification approaches can be considered:

  • CRISPR-Cas9 genome editing: This precise approach allows for clean deletion of the yfbV gene with minimal polar effects on adjacent genes. Design guide RNAs targeting the yfbV locus and include appropriate homology arms for recombination.

  • Lambda Red recombination system: This method, particularly effective in Salmonella, uses homologous recombination to replace yfbV with an antibiotic resistance marker, which can later be removed using FLP recombinase.

  • Antisense RNA strategies: For conditional knockdown, expressing antisense RNA complementary to yfbV mRNA can reduce expression without complete gene deletion.

  • Transposon mutagenesis: While less specific, this approach can generate libraries of mutants that can be screened for insertions in yfbV.

Each approach should be followed by comprehensive phenotypic characterization, including:

  • Growth kinetics in various media and stress conditions

  • Membrane integrity assessments

  • Virulence testing in appropriate model systems

  • Complementation studies to confirm phenotypes are specifically due to yfbV loss

These genetic approaches can be integrated with the recombinant protein studies to build a comprehensive understanding of YfbV function.

What experimental models are most appropriate for studying YfbV's role in Salmonella choleraesuis pathogenesis?

Selecting appropriate experimental models is crucial for understanding YfbV's role in pathogenesis:

  • Cellular models:

    • Macrophage infection assays (e.g., using RAW264.7 or primary macrophages) to study intracellular survival

    • Intestinal epithelial cell lines (e.g., Caco-2, HT-29) for invasion and adherence studies

    • Endothelial cell models to investigate vascular interactions relevant to bacteremia

  • Animal models:

    • Mouse models have been successfully used to study Salmonella vaccine candidates, as evidenced by protection studies with recombinant attenuated vaccines

    • Specific pathogen-free pigs would be particularly relevant as Salmonella Choleraesuis is host-adapted to swine

    • The mouse model demonstrated in the research showed that immunization with attenuated Salmonella strains provided protection against lethal challenges

  • Ex vivo systems:

    • Precision-cut tissue slices from relevant organs

    • Organoids derived from intestinal or vascular tissues

The mouse model has demonstrated utility in Salmonella research, with experimental evidence showing that immunization with recombinant strains SLT17 (pCZ1) or SLT18 (pCZ1) induced specific IgG against heterologous O-antigens and provided protection against lethal challenges , suggesting similar approaches could be valuable for YfbV research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.