Recombinant Salmonella choleraesuis UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yciC; SCH_1730; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_1730

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Salmonella YciC/YqiC protein?

Salmonella YciC (also referred to as YqiC in research literature) forms a homotrimer through its C-terminal coiled-coil domain. The protein structure features a distinctive C-terminal region that facilitates oligomerization, which is critical for its biological function. The trimeric configuration is stabilized through specific interactions within the heptad repeat of the C-terminal region . This oligomeric structure has been confirmed through multiple experimental approaches including chemical crosslinking and size exclusion chromatography coupled with multiple angle light scattering (SEC-MALS) . Understanding this trimeric structure is essential as it relates directly to the protein's functional role in bacterial pathogenesis.

How does the oligomeric state of YciC/YqiC relate to Salmonella virulence?

The trimeric state of YciC/YqiC is crucial for Salmonella virulence. Research has demonstrated that mutations disrupting the protein's ability to form trimers significantly reduce the colonization and invasion capabilities of Salmonella in host cells. In studies utilizing human Caco-2 cell lines, Salmonella strains expressing mutant YqiC variants incapable of trimer formation showed colonization abilities reduced to levels comparable to YqiC knockout strains . Specifically, when complementing a ΔyqiC strain with YqiC containing double or triple mutations in the coiled-coil region, the invasion abilities were reduced to approximately 25-30% of wild-type levels . These findings establish a clear correlation between YqiC oligomerization and bacterial virulence mechanisms.

What molecular interactions mediate YciC/YqiC function in Salmonella?

YciC/YqiC interacts with several crucial components of the bacterial electron transport chain (ETC), which appears to be the primary mechanism through which it influences Salmonella virulence. Pull-down assays coupled with mass spectrometry revealed that YqiC interacts with:

  • Soluble subunits of Complex II (specifically SdhA and SdhB)

  • The β-subunit of F₀F₁-ATP synthase

These interactions suggest that YciC/YqiC modulates bacterial energy production, which subsequently affects the assembly of crucial virulence factors such as flagella. The N-terminal region of YciC/YqiC appears to be primarily responsible for these protein-protein interactions, as demonstrated by experiments with differently tagged protein variants .

What experimental approaches are optimal for studying YciC/YqiC oligomeric states?

Multiple complementary techniques are recommended for comprehensive characterization of YciC/YqiC oligomeric states:

  • Chemical Crosslinking: Effective for capturing transient protein-protein interactions and preserving oligomeric states for analysis. This technique revealed the presence of YqiC trimers and, to a lesser extent, dimeric forms in mutant variants .

  • Size Exclusion Chromatography coupled with Multiple Angle Light Scattering (SEC-MALS): Provides accurate molecular weight determination of protein complexes in solution. SEC-MALS analysis showed that wild-type YqiC has a molecular weight consistent with a trimer (~36 kDa), while mutant variants exhibited weights (~14.5 kDa) closer to monomeric forms .

  • Affinity Chromatography: Using variants with different tag positions (N- versus C-terminal) can provide insights into which protein regions are involved in intermolecular interactions. Research has shown that N-terminal tagging preserves more functional interactions than C-terminal tagging .

When designing experiments, it's important to note that even mutant YqiC proteins designed to disrupt trimerization may retain weak interactions, resulting in heterogeneous samples with small populations of oligomeric structures .

How can mutagenesis approaches be applied to study YciC/YqiC function?

Strategic mutagenesis of YciC/YqiC has proven valuable for understanding structure-function relationships. The following approach is recommended:

  • Target the C-terminal coiled-coil region: Focus on residues within the heptad repeat pattern that are critical for oligomerization. Key mutations that disrupt trimerization include:

    • Single mutations (e.g., R63L) - showed minimal impact on function

    • Double mutations (R49L/L59E, L59E/L69R) - significantly disrupted function

    • Triple mutations (R49L/L59E/L69R) - completely abolished trimerization

  • Complementation studies: Transform plasmids expressing mutant variants into yqiC knockout strains to assess functional restoration. This reveals the in vivo significance of specific structural features.

  • Phenotypic assays: Measure colonization and invasion capabilities using cell culture models (e.g., Caco-2 cells). Quantify bacterial colony-forming units (CFU) as a readout for virulence potential .

This systematic mutagenesis approach can elucidate how specific residues contribute to protein structure and function, providing insights into potential therapeutic targets.

What is the mechanism by which YciC/YqiC affects Salmonella pathogenicity?

YciC/YqiC affects Salmonella pathogenicity through a multi-step mechanism:

  • Energy modulation: By interacting with components of the electron transport chain (ETC) and ATP synthase, YciC/YqiC influences cellular energy production and ATP availability .

  • Flagellar assembly: The altered energy state affects the formation of bacterial flagella, which are energy-intensive structures critical for motility and host colonization.

  • Dominant-negative effects: When mutant and wild-type YciC/YqiC are present together, the mutant variants can interfere with normal trimer formation of wild-type proteins, leading to protein degradation and reduced virulence .

  • Potential involvement in ubiquinone synthesis: Evidence suggests YciC/YqiC may also play a role in ubiquinone (UQ) synthesis, which is essential for electron transport .

  • Regulation of Salmonella Pathogenicity Island (SPI) genes: YciC/YqiC appears to influence the expression of virulence factors through SPI gene loci .

This complex mechanism highlights the multifaceted role of YciC/YqiC in Salmonella pathogenesis and suggests multiple potential intervention points for therapeutic development.

What techniques are effective for studying protein-protein interactions of YciC/YqiC?

Several complementary techniques can be employed to study YciC/YqiC protein-protein interactions:

TechniqueApplicationKey Considerations
Pull-down assaysIdentifying direct protein interaction partnersTag position affects results; N-terminal His- and GST-tagged YqiC co-eluted fewer proteins than C-terminal-tagged versions
Mass spectrometryIdentifying components of protein complexesMS analysis of pull-down samples revealed interactions with SdhA, SdhB, and ATP synthase β-subunit
Co-immunoprecipitationVerifying interactions in cellular contextCan be used to confirm interactions identified in pull-down experiments
Crosslinking coupled with MSMapping interaction interfacesHelps identify specific residues involved in protein-protein contacts
Bacterial two-hybrid systemsScreening for novel interaction partnersUseful for comprehensive interactome analysis

When designing protein interaction studies, consider that the N-terminal region of YciC/YqiC appears to be critical for interactions with other proteins, while the C-terminal region is primarily involved in self-association to form trimers .

How can cell culture models be optimized for studying YciC/YqiC's role in infection?

Cell culture models are essential for investigating the functional impact of YciC/YqiC on Salmonella virulence. Based on available research, the following methodological approach is recommended:

  • Cell line selection: Human intestinal epithelial cell lines such as Caco-2 are appropriate models for studying Salmonella colonization and invasion. These cells form tight junctions and differentiate into enterocyte-like cells, mimicking the intestinal epithelium .

  • Bacterial strain preparation:

    • Generate yqiC knockout strains (e.g., SL1344(ΔyqiC))

    • Create complementary strains by transforming with plasmids expressing wild-type or mutant YciC/YqiC variants

    • Culture bacteria to appropriate growth phase (typically log phase)

  • Infection protocols:

    • For colonization assays: Incubate bacteria with cell monolayers and quantify adherent bacteria by CFU counting

    • For invasion assays: Similar to colonization, but with additional gentamicin treatment to kill extracellular bacteria

  • Competitive assays: To assess the relative fitness of different strains, fluorescent labeling methods similar to those used for Lactobacillus-Salmonella competition studies can be adapted :

    • Competitive adhesion: Simultaneously incubate wild-type and mutant strains

    • Rejection adhesion: Pre-incubate with one strain before adding the second

    • Replacement adhesion: Test the ability of one strain to displace another

  • Data analysis: Quantify results as percentage relative to wild-type strain or absolute CFU counts. Statistical analysis should include multiple biological replicates .

What expression and purification strategies yield functional recombinant YciC/YqiC?

For successful expression and purification of functional recombinant YciC/YqiC, the following protocol is recommended based on published research:

  • Expression system selection:

    • Bacterial expression in E. coli is suitable (e.g., BL21(DE3) strain)

    • Consider tag position carefully: N-terminal tags preserve more interactions with other proteins, while C-terminal tags may interfere less with oligomerization

  • Construct design considerations:

    • Include appropriate affinity tags (His-tag or GST-tag)

    • For functional studies, N-terminal His-tagged constructs are recommended

    • For structural studies of the trimer, C-terminal tagged constructs may be preferred

  • Purification protocol:

    • For His-tagged proteins: Ni-NTA affinity chromatography with stepwise imidazole gradient

    • Buffer optimization is crucial: include appropriate salt concentration and consider adding glycerol for stability

    • Further purification via size exclusion chromatography separates different oligomeric states

  • Quality control:

    • SEC-MALS to confirm oligomeric state

    • Thermal stability assays to assess protein folding

    • Functional assays to confirm activity

  • Storage conditions:

    • Store purified protein in buffer containing stabilizing agents

    • Aliquot and flash freeze in liquid nitrogen

    • Store at -80°C for long-term stability

This protocol can be adapted based on specific experimental requirements and the particular aspects of YciC/YqiC function being investigated.

What are the promising therapeutic targets based on YciC/YqiC research?

Research on YciC/YqiC has revealed several potential therapeutic targets for controlling Salmonella infections:

  • Disruption of trimer formation: Small molecules designed to interfere with the C-terminal coiled-coil interactions could prevent YciC/YqiC trimerization, thereby reducing bacterial virulence .

  • Targeting the interface between YciC/YqiC and ETC components: Compounds that disrupt the interaction between YciC/YqiC and SdhA/SdhB or ATP synthase could interfere with bacterial energy production .

  • Exploiting the dominant-negative effect: Peptide mimetics based on mutant YciC/YqiC sequences could potentially interfere with wild-type protein function.

  • Probiotics approach: Taking inspiration from Lactobacillus competition studies with Salmonella, probiotic strains could be engineered to specifically target YciC/YqiC-dependent processes .

Future research should focus on structural determination of YciC/YqiC in complex with its interaction partners to facilitate structure-based drug design approaches.

How can cross-species comparative analysis enhance our understanding of YciC/YqiC function?

A comparative analysis approach across different bacterial species could provide valuable insights into YciC/YqiC function:

  • Sequence conservation analysis: Identify highly conserved residues across species, which likely indicate functionally important regions.

  • Structural homology modeling: Generate models of YciC/YqiC homologs from different pathogenic and non-pathogenic bacteria to identify structural features unique to virulent strains.

  • Functional complementation studies: Test whether YciC/YqiC from different bacterial species can complement the function in Salmonella yqiC knockout strains.

  • Host-specificity investigation: Compare the interaction of YciC/YqiC from different bacterial species with host cell models to understand host adaptation mechanisms.

  • Evolutionary analysis: Trace the phylogenetic relationships of YciC/YqiC across bacterial species to understand how this protein has evolved in relation to pathogenicity.

This comparative approach could reveal conserved functional mechanisms and species-specific adaptations that could inform both fundamental understanding and therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.