Recombinant Salmonella choleraesuis UPF0283 membrane protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella choleraesuis UPF0283 Membrane Protein YcjF (ycjF)

Recombinant Salmonella choleraesuis UPF0283 membrane protein YcjF (ycjF) is a protein expressed in E. coli and tagged with N-terminal His for purification and identification . The YcjF protein, also known as UPF0283 membrane protein YcjF, is associated with Salmonella choleraesuis and has a full length of 353 amino acids .

CharacteristicDescription
SpeciesSalmonella choleraesuis
SourceE. coli
TagHis
Protein LengthFull Length (1-353aa)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Gene NameycjF
SynonymsycjF; SCH_1677; UPF0283 membrane protein YcjF
UniProt IDQ57NX8
AA SequenceMSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAALRPKRSLWRKMVMGGLALFGASVVGQGLQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVVTEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHETQNDREVVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLINRIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIGAGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Function and Significance

The YcjF protein is annotated as UPF0283, which stands for "Unknown Protein Function" . Despite its unknown specific function, membrane proteins are crucial for various bacterial processes, including transport, signal transduction, and maintaining cell structure . Research indicates that Salmonella employs mechanisms to resist host immune attacks, and outer membrane proteins play a role in these processes .

Applications in Research

Recombinant YcjF protein is used in research applications such as Enzyme-Linked Immunosorbent Assays (ELISA) .

Related Research

  • Outer Membrane Vesicles (OMVs): In Salmonella, the PhoPQ system regulates the production of OMVs, which are enriched with proteins and virulence factors, impacting host-pathogen interactions. PagC, another outer membrane protein, significantly upregulates OMV production and contributes to bacterial survival by interfering with complement activation .

  • Vaccine Development: Attenuated Salmonella choleraesuis strains are being explored as vectors for delivering heterologous antigens to induce immune responses. These strains can be engineered to express specific antigens and have shown promise in generating both humoral and mucosal immunity .

  • Serum Resistance: Research has identified PagC as an outer membrane protein that contributes to serum resistance in Salmonella enterica serovar Choleraesuis, which is crucial for systemic infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; SCH_1677; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGLQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREVVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_1677

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0283 membrane protein YcjF and what is known about its structure?

The YcjF protein belongs to the UPF0283 family of membrane proteins found in various bacterial species including Salmonella choleraesuis. It is a full-length protein comprising 353 amino acids in S. choleraesuis (strain SC-B67) with a UniProt ID of Q57NX8 . The amino acid sequence begins with MSEPLKPRIDFAEPLKE and continues through a series of hydrophobic and hydrophilic regions characteristic of membrane proteins .

Structurally, YcjF contains multiple transmembrane helices that anchor it within the bacterial membrane. The protein includes regions that suggest its integration into the lipid bilayer, with sections exposed to both cytoplasmic and periplasmic environments. YcjF contains several conserved domains typical of membrane transport proteins, though its precise function remains to be fully characterized, as indicated by its UPF (Uncharacterized Protein Family) designation .

What gene encodes the YcjF protein in Salmonella choleraesuis and how is it organized?

The YcjF protein is encoded by the ycjF gene in Salmonella choleraesuis. In strain SC-B67, this gene is designated with the ordered locus name SCH_1677 . The gene exists within the bacterial chromosome rather than on a plasmid, and its transcription appears to be regulated by various environmental factors.

Genomic analysis indicates that ycjF is conserved across multiple bacterial species with high sequence similarity observed between S. choleraesuis and related enterobacteria such as Escherichia coli and Shigella dysenteriae, suggesting evolutionary importance . In Salmonella choleraesuis DSM 14846, the gene is part of the genome sequenced under the Genomic Encyclopedia of Type Strains project .

How does YcjF compare between different bacterial species?

The YcjF protein shows significant conservation across enterobacterial species, though with notable variations in sequence and potentially function. Comparing the amino acid sequences:

SpeciesUniProt IDAmino Acid LengthSequence Similarity to S. choleraesuis YcjF
Salmonella choleraesuisQ57NX8353 aa100% (reference)
Shigella dysenteriaeQ9LA29344 aa~90%
Escherichia coli (K12)C4ZV70partial~88%

What are the optimal methods for recombinant expression of YcjF protein?

Recombinant production of YcjF requires careful consideration of expression systems due to its membrane-embedded nature. The most successful approaches include:

Expression Systems:

  • E. coli expression systems are most commonly used for recombinant production of YcjF

  • Baculovirus expression systems can provide higher yields for certain applications

Critical Factors for Optimal Expression:

  • Growth phase monitoring: Harvesting cells prior to glucose exhaustion, just before the diauxic shift, significantly improves membrane protein yields

  • Growth conditions: Counter-intuitively, the most rapid growth conditions do not yield the best protein production; moderately slowed growth under tightly controlled conditions often proves optimal

  • Expression vectors: His-tagged constructs at the N-terminus improve purification efficiency while maintaining protein functionality

For YcjF specifically, expression in E. coli followed by detergent solubilization has proven effective, though care must be taken to maintain the native conformation of the protein. As noted in Bonander et al., "the differences in membrane protein yields observed under different culture conditions are not reflected in corresponding changes in mRNA levels, but rather can be related to the differential expression of genes involved in membrane protein secretion and cellular physiology" .

What purification strategies are most effective for YcjF membrane protein?

Purification of YcjF presents challenges common to membrane proteins. Based on established protocols:

  • Initial Preparation:

    • Lyophilization of cell pellets containing expressed YcjF

    • Resuspension in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Solubilization:

    • Careful selection of detergents is critical; harsh detergents may denature the protein

    • Mild non-ionic detergents maintain membrane protein structure better than ionic detergents

  • Affinity Chromatography:

    • His-tagged versions of YcjF allow for efficient purification using Ni-NTA columns

    • Elution buffer optimization is critical for maintaining protein activity

  • Storage:

    • Store at -20°C/-80°C with 50% glycerol to maintain stability

    • Avoid repeated freeze-thaw cycles, as this significantly reduces protein activity

    • For short-term work, aliquots may be stored at 4°C for up to one week

What analytical techniques are most suitable for characterizing YcjF?

Multiple analytical approaches can be employed to characterize YcjF structure and function:

  • Gel Electrophoresis:

    • SDS-PAGE for molecular weight confirmation (~39 kDa for YcjF)

    • For improved membrane protein resolution, 16-BAC/SDS-PAGE provides better results than conventional 2D IEF/SDS-PAGE

  • Advanced Structural Analysis:

    • X-ray crystallography has limited success with membrane proteins due to crystallization challenges

    • Cryo-electron microscopy (cryo-EM) offers advantages for membrane protein structural determination without crystallization

    • Nuclear magnetic resonance (NMR) spectroscopy for dynamic studies of specific domains

  • Functional Analysis:

    • Liposome reconstitution assays to study transport activity

    • Fluorescence-based techniques to monitor protein-protein interactions and conformational changes

    • Acceptor photobleaching experiments for in vivo interaction studies

  • Transcriptomic Analysis:

    • RNA sequencing to monitor expression changes under various conditions

    • Promoter activation experiments to study regulation mechanisms

These techniques should be applied in combination for comprehensive characterization, as no single approach provides complete information about membrane protein structure and function.

What is the potential role of YcjF in bacterial stress responses?

While the precise function of YcjF remains to be fully elucidated, emerging evidence suggests its involvement in bacterial stress responses:

  • Transcriptional Regulation:

    • Studies in E. coli indicate that ycjF expression changes under various stress conditions

    • In particular, ycjF was found to be downregulated under heat, cold, and oxidative stress conditions, but not under nitrosative stress

  • Membrane Integrity:

    • As a membrane protein, YcjF may contribute to membrane stability under stress conditions

    • The protein structure suggests potential involvement in membrane transport processes or signaling

  • Metal Homeostasis Connection:

    • Some research indicates a possible connection between ycjF and copper resistance mechanisms

    • The experimental evolution of copper resistance in E. coli produced mutations in multiple genes, potentially affecting ycjF function through regulatory networks

Heat shock experiments have demonstrated that bacterial transcriptome changes are "highly dynamic during continued heat-shock" , and membrane proteins like YcjF may play critical roles in this adaptation process. The differential expression of ycjF under specific stress conditions suggests a specialized function rather than a general stress response protein.

How does YcjF potentially interact with two-component signaling systems?

Two-component systems (TCSs) are critical for bacterial signal transduction, and evidence suggests YcjF may interact with or be regulated by these systems:

  • Protein-Protein Interactions:

    • Pull-down experiments with membrane-integral histidine kinases (HKs) have identified potential interactions with proteins like YcjF

    • Fluorescence resonance energy transfer (FRET) microscopy has been used to study in vivo interactions of TCS components and potentially related membrane proteins

  • Transcriptional Regulation:

    • TCS systems may regulate ycjF expression under specific environmental conditions

    • The CusS/CusR and YedV/YedW two-component systems, which respond to copper and oxidative stress respectively, could potentially influence ycjF expression

  • Membrane Localization:

    • The membrane localization of YcjF places it in proximity to many TCS histidine kinases, facilitating potential functional interactions

    • Cross-talk between different TCS pathways might involve membrane proteins like YcjF as intermediaries or modulators

Research by Fischer et al. noted that "cross-talk between non-cognate components of two-component systems has been assessed in vitro, not much is yet known about cross-talk in vivo" . This highlights a potential research area where YcjF characterization could provide valuable insights into bacterial signaling networks.

What is known about the function of YcjF in Salmonella pathogenesis?

The potential role of YcjF in Salmonella pathogenesis remains largely unexplored, but several lines of evidence suggest possible involvement:

  • Virulence Factor Association:

    • S. choleraesuis is known for its high predilection to cause systemic infections in humans

    • Membrane proteins often play critical roles in bacterial adhesion, invasion, and host-pathogen interactions

  • Genomic Context:

    • Analysis of the S. choleraesuis genome reveals that YcjF is conserved across virulent strains

    • The genomic context of ycjF may provide clues about its functional association with virulence factors

  • Salmonella Pathogenicity Islands:

    • S. choleraesuis contains multiple Salmonella Pathogenicity Islands (SPIs) that contribute to virulence

    • Five SPIs with high percent identity (>95%) were found in S. choleraesuis isolates, including SPI-1, SPI-5, SPI-9, SPI-13, and SPI-14

    • The relationship between YcjF and these virulence-associated genomic regions remains to be investigated

Notably, research on attenuated Salmonella vaccines has utilized S. choleraesuis as a vector for delivering heterologous antigens . Understanding YcjF function could potentially contribute to improved vaccine design or identify new targets for antimicrobial development.

What are the major challenges in studying YcjF and similar membrane proteins?

Researchers face several significant challenges when studying YcjF and other membrane proteins:

  • Structural Determination Difficulties:

    • Membrane proteins are notoriously difficult to crystallize for X-ray crystallography

    • As noted by researchers, "Experimentally determining the structure of membrane proteins has been proven to be more difficult compared to that of other proteins"

    • Extracting membrane proteins often requires detergents that can alter their native conformation

  • Expression and Purification Issues:

    • Membrane protein overexpression can be toxic to host cells

    • Achieving sufficient yields of properly folded protein remains challenging

    • "Membrane protein production is recognized by biologists as the primary bottleneck in contemporary structural genomics programs"

  • Native Environment Simulation:

    • Membrane proteins function in a lipid environment that is difficult to replicate in vitro

    • "Transmembrane proteins are physiologically present in a lipid environment and interact with its components, which is required for their function"

    • Solubilizing these proteins "changes their native environmental conditions and results in an irreversible disruption of their structure"

  • Functional Assay Development:

    • Developing appropriate assays to measure activity of uncharacterized proteins like YcjF is particularly difficult

    • The lack of known substrates or interaction partners complicates functional characterization

These challenges require innovative approaches combining multiple techniques and careful experimental design to overcome.

How can experimental design be optimized when studying YcjF expression under different conditions?

Optimizing experimental design for YcjF studies requires careful consideration of several factors:

  • Replication and Statistical Power:

    • "One of the most common mistakes is attempting statistical analysis with only one sample compared to another single sample"

    • A minimum of three biological replicates is recommended, with more samples providing higher statistical power

  • Growth Conditions Optimization:

    • Growth phase at harvest is critical: "it is crucial to grow cells under tightly-controlled conditions and to harvest them prior to glucose exhaustion, just before the diauxic shift"

    • Monitor multiple parameters simultaneously (pH, temperature, oxygen levels)

    • "The most rapid growth conditions of those chosen are not the optimal production conditions"

  • Control Selection:

    • Include appropriate positive and negative controls

    • Consider using multiple reference genes for normalization in gene expression studies

    • When possible, include wild-type and mutant strains for comparison

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics for comprehensive analysis

    • "The differences in membrane protein yields observed under different culture conditions are not reflected in corresponding changes in mRNA levels"

  • Time-Course Experiments:

    • Dynamic responses are often missed in single time-point experiments

    • "There was a poor overlap among the DEGs at each time point... indicating highly dynamic transcriptome changes during the continued heat-shock"

A thoughtfully designed experimental framework will provide more reliable and interpretable data on YcjF function and regulation.

What novel approaches could advance our understanding of YcjF function?

Several innovative approaches could overcome current limitations in YcjF research:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy (cryo-EM) for high-resolution structural determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to study protein dynamics and conformational changes

    • Solid-state NMR for studying membrane proteins in lipid environments

  • Genetic Approaches:

    • CRISPR-Cas9 genome editing to create precise mutations in ycjF

    • Suppressor mutation analysis to identify functional partners

    • Conditional depletion systems to study essentiality under specific conditions

  • Systems Biology Integration:

    • Network analysis integrating transcriptomics, proteomics, and metabolomics data

    • Machine learning approaches to predict functional partners and regulatory networks

    • Comparative genomics across multiple bacterial species to identify conserved functional modules

  • In Situ Techniques:

    • Super-resolution microscopy to visualize YcjF localization and dynamics in living cells

    • FRET-based biosensors to monitor YcjF activity in real-time

    • Proximity labeling methods (BioID, APEX) to identify interaction partners in native conditions

  • Synthetic Biology Approaches:

    • Designer membrane scaffolds to study YcjF in controlled lipid environments

    • Chimeric proteins to probe domain functions

    • Directed evolution to identify functional variants with enhanced activity

By combining these approaches, researchers may overcome the inherent challenges of studying membrane proteins like YcjF and gain new insights into their biological functions.

How can recombinant YcjF be used to develop novel antimicrobial strategies?

Recombinant YcjF could serve as a platform for antimicrobial development through several approaches:

  • Target Identification:

    • If YcjF proves essential for bacterial survival or virulence, it could become a direct target for novel antimicrobials

    • Structural studies of recombinant YcjF could enable structure-based drug design

    • High-throughput screening against purified YcjF might identify inhibitory compounds

  • Vaccine Development:

    • S. choleraesuis has been used as a vector for vaccine development

    • "Recombinant attenuated Salmonella vaccines (RASV) administered orally induce both humoral and mucosal immune responses to the immunizing antigen"

    • YcjF could potentially serve as a carrier protein or adjuvant in vaccine formulations

  • Antimicrobial Resistance Studies:

    • S. choleraesuis strains have shown increasing resistance to multiple antibiotics

    • "The recent emergence of serotype Choleraesuis that is resistant to ampicillin, chloramphenicol, trimethoprim-sulfamethoxazole, and, notably, fluoroquinolone antibiotics has aroused concern"

    • Understanding YcjF's potential role in stress responses could illuminate resistance mechanisms

  • Diagnostic Applications:

    • Antibodies against YcjF could be developed for diagnostic purposes

    • Species-specific variations in YcjF sequence could enable differentiation between related bacterial pathogens

These applications require further characterization of YcjF function but represent promising avenues for translational research.

What insights can YcjF research provide about bacterial evolution and adaptation?

Research on YcjF can contribute significantly to our understanding of bacterial evolution and adaptation:

  • Evolutionary Conservation:

    • The presence of YcjF across various bacterial species suggests evolutionary importance

    • Comparison of sequence variations can provide insights into selective pressures

    • Phylogenetic analysis revealed "the most recent common ancestor of S. Choleraesuis in ∼1837 (95% credible interval, 1733–1983)"

  • Environmental Adaptation:

    • S. choleraesuis demonstrates remarkable adaptability to various environmental conditions

    • Genomic analysis of different strains has shown that "accessory genes also support the clustering of S. Choleraesuis in the phylogenetic tree"

    • YcjF may contribute to these adaptive processes through its membrane-associated functions

  • Host-Pathogen Co-evolution:

    • S. choleraesuis has a "high predilection to cause systemic infections in humans"

    • Understanding YcjF's potential role in host interaction could illuminate co-evolutionary processes

    • Comparative genomics approaches could identify selection signatures around the ycjF gene

  • Horizontal Gene Transfer:

    • The genomic context of ycjF may provide evidence of horizontal gene transfer events

    • Plasmid-encoded factors often interact with chromosome-encoded proteins like YcjF

    • "Plasmids are also known to be linked to virulence as well as SPIs that linked to virulence in Salmonella"

These evolutionary perspectives can inform both basic science understanding and applied research in infectious disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.