Recombinant Salmonella choleraesuis UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

YihY is produced recombinantly in E. coli, leveraging the His tag for affinity chromatography purification. Key steps include:

  • Cultivation: Optimized in LB medium under antibiotic selection.

  • Harvesting: Centrifugation and lysate preparation under denaturing/native conditions.

  • Purification: Nickel-NTA chromatography followed by buffer exchange into storage-compatible formulations .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol to prevent aggregation .

Research Applications

YihY’s recombinant form is primarily utilized in:

  • Antigen Production: As a membrane-associated protein, it may serve as a candidate for antibody generation or immunological assays.

  • Pathogenicity Studies: Investigating its role in Salmonella invasion and survival in host cells, akin to SPI-1 T3SS effector proteins like SipB .

  • Vaccine Development: Attenuated Salmonella strains (e.g., rSC0016) are engineered to deliver heterologous antigens; YihY could be explored similarly .

Stability and Handling

  • Lyophilization: Enhances long-term stability but requires reconstitution with glycerol-containing buffers.

  • Freeze-Thaw Cycles: Minimize to retain activity; aliquot for single-use applications .

Knowledge Gaps and Future Directions

Current limitations include:

  • Lack of crystallographic or cryo-EM structures for YihY.

  • Unclear mechanistic role in Salmonella physiology.

  • Potential cross-talk with virulence regulators (e.g., CRP) warrants exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yihY; SCH_3917; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links

KEGG: sec:SCH_3917

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Salmonella choleraesuis UPF0761 membrane protein yihY?

The UPF0761 membrane protein yihY from Salmonella choleraesuis (strain SC-B67) is a 290-amino acid transmembrane protein with a characteristic membrane-spanning topology. The full amino acid sequence begins with mLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA and continues through to the C-terminal region. The protein contains multiple hydrophobic domains consistent with its membrane-spanning function, and its UniProt accession number is Q57HI9. The protein's ordered locus name in the Salmonella choleraesuis genome is SCH_3917, indicating its genomic location and context within the bacterial chromosome .

How does yihY protein differ from other membrane proteins in Salmonella species?

The yihY protein belongs to the UPF0761 family, which is characterized by distinct structural features compared to other membrane proteins such as OmpX. While OmpX has been well-characterized as an outer membrane protein involved in bacterial adhesion and invasion with a molecular weight of approximately 23 kDa , yihY is classified as a UPF (uncharacterized protein family) member with less defined functions. Unlike related proteins such as YihE, which has been identified as a protein kinase implicated in the Cpx stress response system and interacts with the transcription termination factor Rho , yihY's functional interactions remain relatively unexplored. These distinctions highlight the need for comparative structural and functional analyses to fully understand yihY's unique properties within the Salmonella membrane proteome.

What are the known functional domains within the yihY protein sequence?

While specific functional domains of yihY have not been fully characterized in the available research, analysis of its amino acid sequence reveals several transmembrane regions and potential binding sites. Researchers studying related membrane proteins have utilized sequence analysis tools to predict functional domains. For instance, related proteins like YihE contain kinase domains that mediate specific interactions with partners such as Rho . Future research should focus on identifying conserved motifs within yihY that might suggest enzymatic activity, protein-protein interaction sites, or signaling functions. Computational approaches including multiple sequence alignments with homologous proteins and structural prediction algorithms would be valuable methodologies for identifying potential functional domains within yihY.

What expression systems are most effective for producing recombinant Salmonella choleraesuis yihY protein?

The most effective expression systems for recombinant yihY protein production would likely follow protocols similar to those used for other recombinant Salmonella proteins. Based on established methodologies, E. coli-based expression systems utilizing pET vectors have demonstrated success for Salmonella membrane proteins. For instance, when expressing recombinant Salmonella OmpX protein, researchers have effectively used the pET28 vector system in E. coli . For optimal expression of membrane proteins like yihY, consider using E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3). Expression should be conducted under controlled conditions, typically at lower temperatures (16-25°C) with reduced inducer concentrations to minimize inclusion body formation. Optimization experiments testing various induction parameters (IPTG concentration, temperature, induction time) are essential for maximizing soluble protein yield.

What purification strategies yield the highest purity and activity for recombinant yihY protein?

Purification of recombinant yihY protein would likely benefit from a multi-step approach similar to methods used for other membrane proteins. Initial purification can be performed using metal affinity chromatography if the protein is expressed with a histidine tag, as seen in the purification protocols for the related YihE protein . For membrane proteins like yihY, solubilization with appropriate detergents (such as n-dodecyl-β-D-maltoside or CHAPS) is critical prior to purification. Following affinity chromatography, size exclusion chromatography (SEC) should be employed to achieve higher purity and to assess the oligomeric state of the protein. For instance, SEC was effectively used to purify the YihE-Rho complex and determine its molecular characteristics . Depending on the downstream applications, additional purification steps such as ion exchange chromatography may be necessary to remove contaminants and achieve >95% purity.

How can researchers optimize storage conditions to maintain yihY protein stability?

For optimal stability of recombinant yihY protein, store the purified protein in a Tris-based buffer containing 50% glycerol at -20°C for routine use, or at -80°C for extended storage . It is critical to avoid repeated freeze-thaw cycles, as this can lead to protein denaturation and aggregation. Working aliquots should be maintained at 4°C for no longer than one week to preserve activity . For membrane proteins like yihY, the inclusion of appropriate detergents above their critical micelle concentration in the storage buffer is essential to maintain native conformation. Additionally, the addition of reducing agents (such as DTT or β-mercaptoethanol) at low concentrations can prevent oxidation of cysteine residues. Stability studies using techniques like circular dichroism or activity assays over time can help determine the optimal buffer composition and storage conditions specific to yihY.

What analytical techniques are most informative for characterizing the structural features of yihY?

For comprehensive structural characterization of yihY, a combination of biophysical techniques should be employed. Circular dichroism (CD) spectroscopy can provide valuable information about secondary structure composition, while fluorescence spectroscopy can offer insights into tertiary structure and conformational changes. For higher-resolution structural analysis, X-ray crystallography should be attempted, though membrane proteins often present crystallization challenges. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative for membrane protein structure determination. Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions and provide insights into protein dynamics. For interaction studies, multiangle laser light scattering (MALLS) analysis, which was successfully used to determine the stoichiometry of the YihE-Rho complex (6:1 ratio) , would be valuable for assessing yihY's oligomeric state and potential interaction partners.

How can researchers determine the membrane topology and orientation of yihY?

Determining membrane topology and orientation of yihY requires specialized approaches for membrane proteins. Computational prediction using algorithms like TMHMM or Phobius can provide initial topology models based on the amino acid sequence. Experimentally, site-directed fluorescence labeling at specific residues followed by fluorescence quenching experiments can help determine which regions are accessible from either side of the membrane. Protease protection assays, where the protein is expressed in membrane vesicles and exposed to proteases, can identify protected domains. Additionally, substituted cysteine accessibility method (SCAM) can be employed by introducing cysteine residues at various positions and assessing their accessibility to membrane-impermeable sulfhydryl reagents. For higher resolution analysis, directed antibody binding to epitope-tagged versions of the protein can provide information on domain orientation relative to the membrane.

What functional assays can be used to investigate potential enzymatic activities of yihY?

Given the limited knowledge about yihY's specific functions, a systematic approach to functional characterization is recommended. Researchers should first investigate its potential role in membrane transport by conducting uptake or efflux assays using radioactively or fluorescently labeled substrates. Since related proteins like YihE have kinase activity , phosphorylation assays using γ-32P-ATP or phosphorylation-specific antibodies should be conducted to test for kinase/phosphatase activity. Pull-down assays and co-immunoprecipitation experiments can identify potential binding partners, similar to how YihE was found to interact with Rho . For more comprehensive functional screening, phenotypic analysis of yihY knockout and overexpression strains should be performed, examining effects on growth rates, stress responses, and virulence phenotypes. Additionally, transcriptomic and proteomic analyses of these modified strains can provide insights into pathways affected by yihY.

How can recombinant yihY protein be utilized in vaccine development strategies?

Recombinant yihY protein could potentially serve as an antigen in vaccine development strategies against Salmonella infections. To explore this application, researchers should follow approaches similar to those used for other Salmonella antigens. First, immunogenicity studies should be conducted by immunizing mice with purified recombinant yihY and evaluating antibody responses through ELISA and other serological assays. If immunogenic, yihY could be incorporated into recombinant attenuated Salmonella vaccine vectors, similar to how researchers have used Salmonella Choleraesuis strain rSC0016 to express heterologous antigens . The advantage of this approach is that it can induce strong mucosal immunity, cell-mediated immunity, and humoral immunity - a mixed Th1/Th2-type response that is particularly effective against bacterial pathogens . The protective efficacy of such vaccines should be evaluated through challenge studies in appropriate animal models, assessing parameters such as bacterial colonization, clinical symptoms, and immunological correlates of protection.

What immune responses are typically elicited by recombinant Salmonella membrane proteins?

Recombinant Salmonella membrane proteins typically elicit multi-faceted immune responses when delivered through appropriate vaccine platforms. Studies with recombinant attenuated Salmonella vaccines have demonstrated induction of strong mucosal immunity (evidenced by secretory IgA in bronchoalveolar lavage fluid), cell-mediated immunity (shown by lymphocyte proliferation and IFN-γ production), and robust humoral immunity with both IgG1 and IgG2a antibody responses . The balance between Th1 and Th2 responses can be assessed by comparing IgG2a (Th1-associated) to IgG1 (Th2-associated) ratios, with many Salmonella antigens promoting a Th1-biased response characterized by higher IFN-γ production compared to IL-4 . For thorough immunological evaluation of yihY, researchers should measure cytokine profiles (including IL-4 and IFN-γ) using ELISPOT assays, assess lymphocyte proliferation responses upon antigen stimulation, and quantify antibody responses using indirect ELISA methods, similar to approaches documented for other Salmonella antigens .

How does the immunological profile of yihY compare with other Salmonella membrane proteins used in vaccine research?

The comparative immunological profile of yihY versus other Salmonella membrane proteins requires systematic investigation. While specific data on yihY's immunogenicity is not well-documented, comparisons can be drawn by examining immune responses to different recombinant Salmonella proteins. For instance, outer membrane proteins like OmpX have been successfully expressed as recombinant proteins and evaluated for serological diagnosis, suggesting their strong antigenicity . When designing comparative studies, researchers should evaluate multiple parameters including:

Immunological ParameterMeasurement MethodExpected Range for Effective Antigens
Antibody Titer (IgG)Indirect ELISAOD450 > 2.1× negative control
Mucosal IgABAL fluid ELISAOD450 > 2.1× negative control
T-cell ProliferationCCK8 assayStimulation Index > 2.0
IFN-γ ProductionELISPOT>50 spots/106 splenocytes
IL-4 ProductionELISPOT>20 spots/106 splenocytes

The ideal immune profile would include strong antibody responses coupled with balanced Th1/Th2 responses, similar to what has been observed with recombinant attenuated Salmonella vaccines expressing heterologous antigens like P42 and P97 .

How might yihY protein interact with host cell receptors during Salmonella infection?

The potential interaction between yihY protein and host cell receptors represents an advanced research question requiring sophisticated methodological approaches. To investigate this, researchers should first determine if yihY is surface-exposed during infection using immunofluorescence microscopy with specific antibodies against yihY. If surface exposure is confirmed, yeast two-hybrid screens or phage display technologies can be employed to identify potential host binding partners. For validation of interactions, surface plasmon resonance (SPR) or bio-layer interferometry (BLI) should be used to quantify binding kinetics. Cell-based assays using recombinant yihY to block Salmonella adhesion/invasion can provide functional evidence of receptor interaction. Additionally, transgenic expression of potential host receptors in non-permissive cell lines followed by binding assays with purified yihY can confirm specificity. More advanced approaches might include proximity labeling techniques such as BioID or APEX2 to identify proteins in close proximity to yihY during infection, potentially revealing transient or weak interactions that might be missed by traditional co-immunoprecipitation approaches.

What role might yihY play in biofilm formation and antibiotic resistance mechanisms?

The potential role of yihY in biofilm formation and antibiotic resistance requires systematic investigation starting with phenotypic analysis of yihY knockout and overexpression strains. Researchers should assess biofilm formation using crystal violet staining assays, confocal microscopy with fluorescently labeled bacteria, and flow cell systems for dynamic biofilm development. Antibiotic susceptibility testing using both planktonic cultures and established biofilms should be performed across multiple antibiotic classes to identify specific resistance patterns. Molecular mechanisms should be explored through transcriptomic analysis (RNA-seq) comparing wild-type and yihY mutant strains under biofilm-inducing conditions, focusing on changes in expression of known biofilm and resistance genes. Proteomic analysis of membrane fractions can identify changes in other membrane proteins that might contribute to altered cell surface properties. Additionally, researchers should examine physical properties of the biofilm matrix, including production of extracellular polymeric substances and structural integrity, to determine if yihY influences matrix composition or architecture.

How can computational modeling enhance our understanding of yihY protein dynamics in the membrane environment?

Computational modeling offers powerful approaches to understand yihY dynamics within membrane environments. Researchers should begin with homology modeling based on related membrane proteins with known structures, followed by refinement through molecular dynamics (MD) simulations. Coarse-grained MD simulations can model the protein's behavior within lipid bilayers over extended timescales (microseconds), capturing large-scale conformational changes and lipid interactions. More detailed all-atom MD simulations can examine specific interactions at binding sites or within transmembrane domains. Advanced techniques like Markov state modeling can identify metastable conformational states and transition pathways. Free energy calculations using methods such as umbrella sampling can determine energetic barriers for substrate transport or conformational changes. Integration of experimental data, such as distance constraints from cross-linking studies or accessibility data from cysteine labeling, can further refine computational models. These approaches have successfully elucidated dynamics of other membrane proteins and could provide critical insights into yihY function that are difficult to obtain experimentally.

What are common challenges in expressing recombinant membrane proteins like yihY and how can they be overcome?

Expressing recombinant membrane proteins like yihY presents several challenges that require systematic troubleshooting. Common issues include protein misfolding, aggregation, toxicity to host cells, and low yield. To overcome these challenges, researchers should:

  • Expression system optimization: Test multiple E. coli strains specifically designed for membrane protein expression (C41(DE3), C43(DE3), Lemo21(DE3)). Evidence from YihE expression studies indicates that overexpression can affect cell viability, suggesting careful titration of expression levels is crucial .

  • Induction parameters: Reduce expression temperature (16-20°C), decrease inducer concentration (25-100 μM IPTG instead of 1 mM), and extend expression time (overnight) to promote proper folding. Growth curves should be monitored to determine optimal harvesting time, as demonstrated in studies with other recombinant Salmonella proteins .

  • Solubilization screening: Test a panel of detergents (DDM, LDAO, Triton X-100, CHAPS) at various concentrations to identify optimal solubilization conditions while maintaining protein structure and function.

  • Fusion tags: Consider fusion partners known to enhance membrane protein solubility, such as MBP (maltose-binding protein) or SUMO, in addition to His-tags used for purification.

  • Codon optimization: Adjust the coding sequence for optimal codon usage in the expression host to improve translation efficiency.

Implementing these strategies in a systematic manner, with careful documentation of expression conditions and outcomes, typically resolves most membrane protein expression challenges.

How can researchers address protein aggregation issues during purification of yihY?

Protein aggregation during yihY purification requires a multi-faceted troubleshooting approach. To address this common challenge:

  • Buffer optimization: Screen various buffer compositions by varying pH (6.0-8.5), salt concentration (100-500 mM NaCl), and including stabilizing additives such as glycerol (10-20%) or specific ions (Mg2+, Ca2+) that may stabilize the native conformation.

  • Detergent management: Maintain detergent concentrations above critical micelle concentration throughout all purification steps, and consider detergent exchange during purification to identify optimal conditions for protein stability.

  • Reducing agents: Include fresh reducing agents (DTT, TCEP, or β-mercaptoethanol) to prevent disulfide-mediated aggregation, particularly important if yihY contains multiple cysteine residues.

  • Temperature control: Perform all purification steps at 4°C and minimize exposure to room temperature, which can accelerate aggregation of membrane proteins.

  • Removal of aggregates: Incorporate a centrifugation step (100,000 × g for 30 minutes) before chromatography to remove pre-formed aggregates, and include a pre-column filtration step (0.22 μm).

  • Gentle elution: Use gradient elution rather than step elution from affinity columns to minimize local concentration effects that may promote aggregation.

  • Analysis of aggregation: Employ dynamic light scattering (DLS) or analytical ultracentrifugation to monitor the aggregation state of purified protein and optimize conditions accordingly.

These strategies have proven effective for other membrane proteins and should be systematically tested for yihY purification.

What strategies can improve antibody production against poorly immunogenic regions of yihY protein?

Generating antibodies against poorly immunogenic regions of membrane proteins like yihY requires specialized approaches to enhance immune responses:

  • Peptide design: Identify potentially antigenic regions using epitope prediction algorithms, focusing on hydrophilic, surface-exposed segments rather than transmembrane domains. Create synthetic peptides of these regions (15-25 amino acids) conjugated to carrier proteins like KLH or BSA.

  • Recombinant fragment approach: Express soluble domains or fragments of yihY as separate recombinant proteins, avoiding hydrophobic transmembrane regions that often yield poor antibody responses.

  • Adjuvant selection: Test multiple adjuvants beyond standard Freund's, including TLR agonists (CpG, Poly I:C), aluminum salts, or specialized commercial adjuvants designed to enhance responses against difficult antigens.

  • Immunization protocol optimization: Implement extended immunization schedules with increased rest periods between boosts (4-6 weeks instead of 2-3 weeks) to allow affinity maturation, and employ DNA prime-protein boost strategies.

  • Host selection: If initial attempts in mice yield poor results, consider alternative host species such as rabbits, guinea pigs, or chickens, which may recognize different epitopes due to MHC differences.

  • Phage display antibody libraries: Utilize synthetic antibody libraries with in vitro selection to overcome limitations of in vivo immunization, particularly valuable for conserved bacterial proteins that may cross-react with host proteins.

  • Monoclonal antibody screening: Generate a large panel of monoclonal antibodies and implement comprehensive screening to identify rare clones recognizing poorly immunogenic epitopes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.