Recombinant Salmonella choleraesuis Virulence sensor histidine kinase PhoQ (phoQ)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
phoQ; SCH_1181; Virulence sensor histidine kinase PhoQ; Sensor histidine protein kinase/phosphatase PhoQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
phoQ
Target Protein Sequence
MNKFARHFLPLSLRVRFLLATAGVVLVLSLAYGIVALVGYSVSFDKTTFRLLRGESNLFY
TLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFH
EIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDT
IPIELKRSYMVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIEALAREVRELEDHHREMLN
PETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSV
SKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKG
VNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPG
IPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQ
HPTQKEE
Uniprot No.
Target Background
Function
PhoQ is a member of the two-component PhoP/PhoQ regulatory system in Salmonella choleraesuis. This system controls the expression of genes involved in virulence and resistance to antimicrobial peptides produced by the host. Under conditions of low periplasmic Mg2+, PhoQ functions as a membrane-bound histidine kinase, undergoing autophosphorylation and subsequently transferring the phosphate group to PhoP. This phosphorylation activates PhoP-activated genes (PAGs) and represses PhoP-repressed genes (PRGs). Conversely, in high periplasmic Mg2+, PhoQ acts as a phosphatase, dephosphorylating phospho-PhoP. This leads to repression of PAGs and may induce the expression of some PRGs.
Database Links
KEGG: sec:SCH_1181
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
