Recombinant Salmonella choleraesuis Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
zntB; SCH_1651; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella choleraesuis (strain SC-B67)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGHGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links

KEGG: sec:SCH_1651

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and how does it function in zinc homeostasis?

ZntB is a zinc transport protein in Salmonella enterica that plays a role in zinc homeostasis. Unlike the zinc efflux transporters ZntA and ZitB, which are critical for mitigating the cytotoxic effects of free zinc, ZntB is involved in zinc uptake mechanisms. Zinc homeostasis is crucial for bacterial survival as zinc serves as a cofactor for several essential proteins but becomes toxic at elevated concentrations . The regulation of zinc levels involves a coordinated system of uptake and efflux proteins that respond to environmental zinc concentrations.

In Salmonella, zinc transporters are particularly important during host infection, as macrophages produce nitric oxide (NO·) that can disrupt zinc binding in metalloproteins, leading to elevated free intracellular zinc that requires efflux to maintain viability .

How is ZntB regulated in response to environmental conditions?

ZntB expression is regulated in response to zinc availability, similar to other zinc transporters. While the search results don't specifically address ZntB regulation, we can observe that zinc transport systems in Salmonella are critical during infection conditions, particularly when the bacteria face nitrosative stress. Under nitric oxide exposure, zinc metalloproteins such as DnaG, PriA, and TopA become targets of NO·-mediated modification, which can release zinc from these proteins . This creates an intracellular zinc burden that must be managed through regulated transport systems.

What is the relationship between ZntB and other zinc transporters in Salmonella?

Salmonella employs multiple zinc transporters that work in coordination to maintain proper zinc homeostasis. The ZntA and ZitB zinc efflux transporters have been shown to be required for Salmonella resistance to zinc overload and nitrosative stress in vitro . These transporters mitigate the cytotoxic actions of free zinc mobilized by NO· exposure. While ZntB's specific interactions with ZntA and ZitB aren't detailed in the search results, these proteins likely function in a complementary manner within the zinc homeostasis network, with ZntB potentially involved in zinc uptake while ZntA and ZitB manage zinc efflux.

What vector systems are most effective for recombinant ZntB expression?

For recombinant expression of zinc transport proteins in Salmonella, balanced lethal systems using complementation of essential genes have proven effective. Based on research with other recombinant proteins in Salmonella Choleraesuis, a vector system utilizing the aspartate semialdehyde dehydrogenase (asd) gene complementation provides excellent stability for heterologous protein expression .

For ZntB expression, a plasmid similar to the pYA3943 prokaryotic plasmid containing the pBR ori and asd genes would be appropriate, as this system has demonstrated stable maintenance for over 50 passages in recombinant Salmonella Choleraesuis strains . This balanced lethal system ensures plasmid retention and continuous expression of the target protein.

How can I confirm successful expression of recombinant ZntB?

Verification of recombinant protein expression can be accomplished through several complementary methods:

  • Western blotting (WB) analysis using specific antibodies against ZntB or any epitope tags incorporated into the recombinant construct. This approach has been successfully used to verify PlpE protein expression in recombinant Salmonella .

  • PCR amplification of the inserted gene from the recombinant strain, followed by restriction enzyme digestion to confirm the presence of the correct insert. As demonstrated with the pS-PlpE plasmid, digestion with appropriate restriction enzymes (such as EcoRI and SalI) can verify successful construction .

  • DNA sequencing of the constructed plasmid to confirm the integrity of the zntB gene sequence.

  • Functional assays to verify the activity of the expressed ZntB protein, such as measuring zinc transport in the recombinant strain compared to control strains.

What strategies can improve expression levels of recombinant ZntB?

To optimize expression of recombinant ZntB in Salmonella Choleraesuis, consider implementing these strategies:

  • Use of regulated delayed expression systems to balance bacterial growth with protein production. The regulated delayed exogenous synthesis system employed in the rSC0016 strain provides a model for this approach .

  • Codon optimization of the zntB gene sequence for optimal expression in Salmonella Choleraesuis.

  • Selection of appropriate promoters that provide strong but controlled expression. Promoters that can be regulated by environmental signals present in the target tissues may enhance expression at the desired location and time.

  • Incorporation of secretion signals if extracellular localization or surface display of ZntB is desired, similar to the approach used for the PlpE protein in the rSC0016(pS-PlpE) construct .

  • Engineering of the host strain to reduce metabolic burden and improve protein folding, such as by knocking out unnecessary or competing pathways.

What are the best methods to study ZntB function in vitro?

To investigate ZntB function in vitro, researchers should consider multiple complementary approaches:

  • Membrane vesicle transport assays: Prepare inside-out membrane vesicles from recombinant Salmonella expressing ZntB and measure zinc transport using fluorescent zinc indicators or radioactive zinc isotopes.

  • Protein purification and reconstitution: Purify recombinant ZntB and reconstitute it into proteoliposomes for direct measurement of transport activity.

  • Site-directed mutagenesis: Create specific mutations in conserved regions of ZntB to identify residues critical for zinc binding and transport.

  • Zinc accumulation assays: Compare zinc accumulation in wild-type versus zntB mutant strains using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS).

  • Electrophysiology: If applicable, use patch-clamp techniques with reconstituted ZntB to measure zinc ion currents across membranes.

How can I assess the impact of ZntB on bacterial virulence?

To evaluate the role of ZntB in Salmonella virulence, consider these experimental approaches:

  • Construction of zntB deletion mutants: Create isogenic mutants lacking zntB and compare their virulence to wild-type strains.

  • Infection models: Use appropriate animal models, such as mice, to assess the virulence of wild-type versus zntB mutant Salmonella, similar to approaches used for evaluating other recombinant Salmonella strains .

  • Macrophage survival assays: Compare the survival of wild-type and zntB mutant strains in activated macrophages producing nitric oxide, as NO·-dependent zinc mobilization has been shown to affect bacterial survival .

  • Complementation studies: Reintroduce the zntB gene on a plasmid to confirm that observed virulence defects are specifically due to the absence of ZntB.

  • Gene expression analysis: Analyze changes in expression of virulence genes in response to zntB mutation to identify potential regulatory connections.

What controls should be included when studying zinc transport proteins?

Proper experimental controls are essential for studying zinc transport proteins:

  • Empty vector controls: Include strains containing the vector backbone without the zntB insert to control for vector effects .

  • Mutant protein controls: Include strains expressing mutated versions of ZntB with alterations in key functional residues.

  • Other zinc transporter mutants: Include strains with mutations in known zinc transporters (e.g., zntA, zitB) for comparison .

  • Metal specificity controls: Include assays with other divalent metals to confirm zinc specificity of the observed effects.

  • Environmental controls: Maintain consistent zinc concentrations in growth media and experimental buffers, as environmental zinc can significantly affect results.

How does nitric oxide stress affect ZntB expression and function?

Nitric oxide (NO·) produced by activated macrophages significantly impacts zinc homeostasis in Salmonella. NO· can disrupt zinc metalloproteins through S-nitrosylation and other mechanisms, releasing bound zinc and creating intracellular zinc toxicity . While the search results don't specifically address ZntB regulation under nitrosative stress, we can infer that:

  • NO· exposure likely affects the expression of zinc transporters, including ZntB, as part of the bacterial response to maintain zinc homeostasis.

  • The mobilization of free zinc by NO· creates conditions where zinc transport systems become critical for bacterial survival.

  • Bacteria lacking proper zinc transport capabilities show increased sensitivity to nitrosative stress, highlighting the importance of these systems during infection .

Research approaches to study NO· effects on ZntB would include:

  • Measuring zntB expression changes in response to NO· donors

  • Comparing the survival of wild-type and zntB mutant strains under nitrosative stress

  • Investigating protein-protein interactions between ZntB and other components of the NO· response system

What is the relationship between zinc transport proteins and bacterial immune evasion?

Zinc transport systems play significant roles in bacterial immune evasion strategies:

  • During infection, activated macrophages produce NO· that mobilizes free zinc in bacterial cells, creating toxic conditions. Efficient zinc efflux through transporters like ZntA and ZitB is required for bacterial survival in this environment .

  • Zinc homeostasis proteins contribute to bacterial virulence, as demonstrated by the requirement for zinc efflux transporters for Salmonella virulence in NO·-producing mice .

  • The ability to maintain proper zinc balance likely affects the expression of virulence factors and stress response systems that help bacteria evade host immune defenses.

To investigate these relationships, researchers could:

  • Compare immune responses to wild-type versus zinc transporter mutant strains

  • Evaluate bacterial survival in various immune cell types with different zinc sequestration capabilities

  • Assess the impact of zinc availability on virulence gene expression

How can computational approaches enhance our understanding of ZntB function?

Computational approaches provide valuable insights into zinc transport protein function:

  • Homology modeling: Generate structural models of ZntB based on related zinc transporters with known structures to predict zinc binding sites and transport mechanisms.

  • Molecular dynamics simulations: Simulate ZntB interaction with zinc ions and membrane environments to understand conformational changes during transport.

  • Genomic analyses: Compare zntB sequences across Salmonella strains and related bacteria to identify conserved regions critical for function.

  • Systems biology approaches: Model the integrated zinc homeostasis network to understand how ZntB functions within the broader context of bacterial metabolism.

  • Virtual screening: Identify potential inhibitors of ZntB through computational screening of chemical libraries for drug development.

How can I resolve inconsistent results in zinc transport protein studies?

When facing inconsistent results in zinc transport protein research, consider these approaches:

  • Standardize zinc concentrations: Ensure consistent zinc levels in growth media and experimental buffers, as trace metal contamination can significantly affect results.

  • Control bacterial growth conditions: Standardize growth phase and media composition, as these factors affect transporter expression.

  • Verify protein expression: Confirm consistent expression levels of recombinant proteins across experiments using quantitative Western blot analysis .

  • Check plasmid stability: Verify the stability of expression plasmids over multiple passages, particularly for long-term experiments .

  • Optimize assay conditions: Systematically optimize pH, temperature, and buffer compositions for transport assays.

  • Use multiple measurement methods: Apply complementary techniques to measure zinc transport or binding to cross-validate results.

What statistical approaches are appropriate for analyzing zinc transport data?

For rigorous analysis of zinc transport data, consider these statistical approaches:

  • Kinetic modeling: Apply Michaelis-Menten or other appropriate models to analyze transport kinetics and determine parameters like Km and Vmax.

  • Repeated measures ANOVA: Use this for time-course experiments measuring zinc transport under different conditions.

  • Multiple comparison tests: When comparing multiple strains or conditions, apply appropriate corrections for multiple testing (e.g., Bonferroni, Tukey's HSD).

  • Non-linear regression: For analyzing dose-response relationships between zinc concentration and transport activity.

  • Mixed-effects models: Useful for experiments with both fixed and random effects, such as when measuring zinc transport across different bacterial strains and experimental conditions.

How do I interpret contradictory findings about zinc transporter function?

When faced with contradictory findings about zinc transporters like ZntB:

  • Consider strain differences: Genetic background can significantly affect transporter function. Even within Salmonella Choleraesuis, there are different variants with distinct biochemical behaviors .

  • Evaluate experimental conditions: Differences in growth conditions, zinc concentrations, or assay methods may explain contradictory results.

  • Assess protein expression levels: Variation in expression levels can affect functional studies. Verify consistent expression using quantitative methods .

  • Examine post-translational modifications: Modifications like S-nitrosylation can affect protein function and may vary between experimental systems .

  • Consider technical limitations: Each measurement technique has inherent limitations and biases that should be acknowledged when interpreting contradictory results.

  • Integrate multiple data types: Combine functional assays, structural studies, and genetic approaches to develop a more complete understanding of transporter function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.