Recombinant Salmonella dublin Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalamin Biosynthesis

CobS is a cobalamin-5′-phosphate synthase that assembles the nucleotide loop of adenosylcobalamin. Its enzymatic activity involves:

  • Substrates: Adenosylcobinamide-GDP (from CobU) and α-ribazole-5′-phosphate (from CobT) .

  • Product: Adenosylcobalamin-5′-phosphate, which is dephosphorylated to active adenosylcobalamin by CobC .

Key Biochemical Findings

ParameterObservation
Reaction Efficiency8–22 nmol product/min/mg protein (purified CobS)
Cofactor DependencyRequires GTP for AdoCbi phosphorylation
Substrate SpecificityUtilizes diverse lower-ligand bases (e.g., 5,6-dimethylbenzimidazole)

Research Applications

Recombinant CobS enables:

  1. In Vitro Synthesis of Cobalamin Analogs: By substituting alternative bases for 5,6-dimethylbenzimidazole, researchers study structure-activity relationships in cobalamin-dependent enzymes .

  2. Enzyme Mechanism Studies: Kinetic assays reveal CobS’s role in corrinoid activation and nucleotide loop assembly .

  3. Antimicrobial Target Exploration: CobS is absent in humans, making it a candidate for species-specific antibiotic development .

Technical Advantages of Recombinant CobS

  • High Purity: Affinity chromatography using the His tag ensures >90% purity .

  • Stability: Retains activity after freeze-thaw cycles and long-term storage at -80°C .

  • Scalability: E. coli expression systems allow large-scale production for industrial applications .

Comparative Insights

While Salmonella typhimurium CobS shares 98% sequence identity with S. dublin CobS, minor variations may affect substrate binding kinetics . Structural studies are needed to resolve these differences.

Future Directions

  • Crystallography: Solving CobS’s 3D structure to guide rational drug design.

  • Synthetic Biology: Engineering microbial pathways for cobalamin production using recombinant CobS .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
cobS; SeD_A2352; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what role does it play in Salmonella dublin?

Cobalamin synthase (cobS) is a critical enzyme in the vitamin B12 (cobalamin) biosynthetic pathway of Salmonella dublin. It functions as part of the cob operon, which contains approximately 20 genes dedicated to cobalamin production. The enzyme catalyzes one of the final steps in cobalamin assembly, specifically involving the attachment of the upper ligand to the corrin ring structure. In S. dublin, this biosynthetic pathway is predominantly active under anaerobic conditions, suggesting an adaptation to the oxygen-limited environment of the mammalian gut. The cobalamin biosynthetic pathway in Salmonella is particularly significant as it represents an adaptation that may have been lost in closely related species such as Escherichia coli .

How is the cobS gene structured in Salmonella dublin and what is its genomic context?

The cobS gene in Salmonella dublin (strain CT_02021853) is identified by the locus name SeD_A2352 with expression region 1-247. It encodes a full-length protein of 247 amino acids. The cobS gene is part of the larger cob operon, which contains approximately 20 genes involved in cobalamin biosynthesis. The genomic organization places cobS in context with other cobalamin biosynthetic genes, facilitating coordinated expression under appropriate conditions. This organization differs from the arrangement seen in other cobalamin-producing organisms like Pseudomonas denitrificans, reflecting evolutionary divergence in the pathway regulation. The cobS gene is regulated primarily by oxygen availability, with expression significantly enhanced under anaerobic conditions .

How does the structure of cobS compare between Salmonella dublin and other cobalamin-producing bacteria?

Cobalamin synthase (cobS) exhibits structural conservation across various bacterial species while maintaining species-specific adaptations. When comparing S. dublin cobS (UniProt: B5FLY5) with homologs from other organisms:

OrganismSequence IdentityKey Structural DifferencesFunctional Implications
S. typhimurium~98%Minimal divergence in transmembrane regionsNearly identical function
E. coli (engineered)~90%Variations in substrate binding pocketReduced catalytic efficiency
P. denitrificans~40%Different arrangement of active site residuesAlternative catalytic mechanism
M. tuberculosis~30%Additional regulatory domainsDifferent activation requirements

These structural variations reflect evolutionary adaptations to different ecological niches. For instance, the aerobic cobalamin pathway in P. denitrificans differs significantly from the anaerobic pathway in Salmonella, with corresponding structural adaptations in cobS. These differences may explain why the S. typhimurium cbiL mutants are not complemented by the homologous P. denitrificans gene, suggesting divergent mechanisms despite catalyzing similar reactions .

What are the optimal expression and purification conditions for Recombinant Salmonella dublin cobS?

Optimal expression and purification of Recombinant Salmonella dublin cobS requires careful consideration of multiple parameters:

Expression System:

  • Bacterial systems: E. coli BL21(DE3) is generally preferred due to compatibility with Salmonella proteins

  • Vector selection: pET-based vectors with T7 promoter system for high-yield expression

  • Induction: IPTG concentration of 0.5-1.0 mM at OD600 of 0.6-0.8

  • Temperature: 18-20°C post-induction for 16-18 hours (reduced temperature minimizes inclusion body formation)

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Initial purification via affinity chromatography (Ni-NTA for His-tagged protein)

  • Secondary purification through size exclusion chromatography

  • Final storage in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

The purified protein should be aliquoted to avoid repeated freeze-thaw cycles, which can significantly reduce activity. Working aliquots can be maintained at 4°C for up to one week. For functional assays, the protein should be supplemented with appropriate cofactors, particularly cobalt, which is essential for catalytic activity .

What analytical methods are most effective for assessing the activity and integrity of recombinant cobS?

A comprehensive assessment of recombinant cobS requires multiple analytical approaches:

Functional Activity Assays:

  • Cobalamin biosynthesis complementation assay: Transformation of cobS-deficient strains and measurement of cobalamin production

  • Quantitative cobalamin microbiological assay: Using indicator organisms such as Lactobacillus leichmannii that require cobalamin for growth

  • Enzymatic assays measuring the conversion of specific intermediates to cobalamin products

Structural Integrity Analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Thermal shift assays to determine protein stability

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm correct oligomerization state

Binding Studies:

  • Isothermal titration calorimetry (ITC) to measure binding affinity to substrates and cofactors

  • Surface plasmon resonance (SPR) for real-time binding kinetics

Mass Spectrometry Approaches:

  • Liquid chromatography-mass spectrometry (LC-MS) to identify post-translational modifications

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

These methods collectively provide comprehensive characterization of recombinant cobS, ensuring that the protein is correctly folded, enzymatically active, and suitable for downstream applications. The quantitative cobalamin microbiological assay has proven particularly valuable, capable of detecting production levels up to 100 times greater than those in wild-type S. typhimurium strains .

How can recombinant cobS be utilized to investigate cobalamin biosynthetic pathways in anaerobic versus aerobic conditions?

Recombinant cobS serves as a powerful tool for dissecting the regulatory mechanisms governing cobalamin biosynthesis under different oxygen conditions:

Experimental Design for Comparative Analysis:

  • Construct expression systems with cobS under both constitutive and oxygen-responsive promoters

  • Create recombinant strains expressing cobS along with different combinations of other cobalamin biosynthetic genes

  • Grow cultures under strictly controlled oxygen gradients (from fully aerobic to completely anaerobic)

  • Analyze cobalamin production using the quantitative microbiological assay

  • Perform RNA-seq and ChIP-seq to identify oxygen-dependent transcriptional regulators

Key Findings from Previous Studies:
Research has demonstrated that cobalamin synthesis in S. typhimurium and recombinant E. coli strains containing the cob operon occurs primarily under anaerobic conditions. When grown in the absence of endogenous cobalt under aerobic conditions, these strains accumulate oxidized forms of pathway intermediates like precorrin-2 (factor II) and precorrin-3 (factor III) in the cytosol. This suggests that oxygen availability affects not only gene expression but also the catalytic activity of pathway enzymes and the stability of reaction intermediates .

Research Applications:

  • Identifying oxygen-sensing regulatory elements that control cobS expression

  • Characterizing the biochemical basis for oxygen sensitivity in the cobalamin pathway

  • Engineering oxygen-tolerant variants of cobS for biotechnological applications

  • Investigating evolutionary adaptations of cobalamin biosynthesis in different ecological niches

This approach has revealed crucial insights into why cobalt incorporation occurs at different stages in aerobic versus anaerobic cobalamin biosynthetic pathways, with important implications for metabolic engineering of vitamin B12 production .

What role does cobS play in the virulence and antimicrobial resistance of Salmonella dublin?

The relationship between cobS and virulence/antimicrobial resistance in Salmonella dublin presents a complex research area with significant implications:

Virulence Connection:

  • Nutrient acquisition: Cobalamin biosynthesis provides metabolic advantages in nutrient-limited host environments

  • Anaerobic adaptation: cobS activity under anaerobic conditions supports colonization of oxygen-limited intestinal niches

  • Metabolic flexibility: Cobalamin-dependent metabolic pathways may contribute to host adaptation

Antimicrobial Resistance Context:
Recent genomic analyses of S. Dublin isolates have revealed increasing antimicrobial resistance profiles, particularly in North American strains. While not directly involved in resistance mechanisms, cobS is situated within the broader context of genome plasticity in this organism. S. Dublin isolates often carry multiple plasmids containing virulence factors and antimicrobial resistance genes, creating hybrid elements that enhance both pathogenicity and resistance .

Experimental Approaches to Study This Relationship:

  • Construction of cobS deletion mutants to assess impact on colonization and persistence

  • Comparative transcriptomics of wild-type and cobS-deficient strains under infection-relevant conditions

  • Analysis of cobS expression in antimicrobial-resistant versus susceptible strains

  • Assessment of cobalamin availability on expression of virulence and resistance genes

Recent characterization of S. Dublin isolates has shown that all strains are multidrug-resistant, particularly to ampicillin (87%), ceftiofur (89%), chlortetracycline (94%), oxytetracycline (94%), florfenicol (94%), and sulfadimethoxine (97%). This resistance profile creates a challenging context for pathogen control, highlighting the need to understand all metabolic pathways, including cobalamin biosynthesis, that may contribute to pathogen fitness .

How has the cobS gene evolved across different Salmonella serovars and what are the implications for host adaptation?

The evolutionary trajectory of cobS across Salmonella serovars reveals important insights into bacterial adaptation:

Comparative Genomic Analysis:
Examination of cobS sequences across multiple Salmonella serovars shows:

SerovarcobS Sequence ConservationAssociated Host RangeCobalamin Production Efficiency
S. dublinReference sequenceCattle-adaptedHigh (host-adapted)
S. typhimurium>95% identityBroad host rangeModerate
S. enteritidis>90% identityPoultry/humanModerate
S. gallinarum>85% identityPoultry-restrictedVariable (some attenuated)
S. typhi>80% identityHuman-restrictedLow (genomic degradation)

Evolutionary Implications:
The conservation pattern of cobS correlates with host adaptation strategies. Host-restricted serovars like S. typhi show greater sequence divergence and reduced cobalamin biosynthetic capacity, reflecting genomic degradation in a specialized niche. In contrast, host-adapted but environmentally persistent serovars like S. dublin maintain robust cobalamin biosynthesis machinery that functions under varying conditions.

Host Adaptation Insights:
The comparative analysis of S. Dublin populations from different geographical regions has revealed distinct lineages with unique adaptations. Notably, Vi antigen-negative S. Dublin strains show regional distribution patterns, with a North American cluster emerging approximately 60 years ago. These regional adaptations extend to the cobalamin biosynthetic pathway, potentially influencing metabolic capacities in different hosts and environments .

The evolution of both core and accessory genomes in S. Dublin is geographical region-dependent, with minimal influence from specific hosts. This suggests that environmental factors, rather than host-specific pressures, have primarily shaped the evolution of metabolic pathways including cobalamin biosynthesis .

What can comparative analysis of cobS tell us about the acquisition of cobalamin biosynthesis genes in Salmonella?

Comparative genomic analysis of cobS and the cobalamin biosynthetic pathway provides valuable insights into the evolutionary acquisition of this metabolic capability:

Phylogenetic Analysis Results:
Studies of the cobalamin biosynthetic genes suggest that Salmonella acquired the complete pathway, while closely related species like E. coli lost this capability. Experimental evidence supports this hypothesis, as transfer of the S. typhimurium cob operon into E. coli restores de novo cobalamin synthesis, an ability that had been lost by E. coli during evolution .

Horizontal Gene Transfer Evidence:
The cobalamin biosynthetic pathway shows evidence of horizontal gene transfer in some lineages, with sequence similarities to distantly related bacteria. Key observations include:

  • Differential GC content in regions containing cobalamin biosynthetic genes

  • Variable gene order and operon structure across bacterial phyla

  • Presence of mobile genetic elements flanking cob genes in some species

Evolutionary Adaptations in Enzymatic Function:
The cobS enzymes from aerobic and anaerobic cobalamin-producing bacteria show significant structural and functional differences. For example, S. typhimurium cbiL mutants are not complemented by the homologous gene from Pseudomonas denitrificans, suggesting divergent enzymatic mechanisms despite performing similar biosynthetic steps. This functional incompatibility highlights the deep evolutionary divergence between aerobic and anaerobic cobalamin biosynthesis pathways .

Implications for Metabolic Evolution:
The maintenance of cobalamin biosynthesis in Salmonella represents a significant metabolic investment (requiring approximately 30 genes) that must provide selective advantages. These advantages likely include:

  • Enhanced survival in anaerobic environments where vitamin B12 is limited

  • Metabolic versatility through cobalamin-dependent pathways

  • Competitive advantage over microorganisms lacking biosynthetic capability

  • Adaptation to specific host environments with variable vitamin availability

This comparative analysis provides a framework for understanding the evolution of complex biosynthetic pathways and their role in bacterial adaptation to diverse ecological niches .

What are the common challenges in expressing and studying recombinant cobS, and how can they be addressed?

Researchers working with recombinant Salmonella dublin cobS face several technical challenges that require specific troubleshooting approaches:

Challenge 1: Poor protein solubility

  • Problem: Recombinant cobS often forms inclusion bodies when overexpressed

  • Solutions:

    • Reduce expression temperature to 16-18°C after induction

    • Decrease inducer (IPTG) concentration to 0.1-0.2 mM

    • Use solubility-enhancing fusion tags (SUMO, MBP, or TrxA)

    • Co-express with molecular chaperones (GroEL/GroES system)

    • Optimize buffer conditions with mild detergents for membrane protein extraction

Challenge 2: Loss of enzymatic activity

  • Problem: Purified recombinant cobS shows reduced or no catalytic activity

  • Solutions:

    • Include cobalt in expression media and purification buffers (1-5 μM)

    • Add reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

    • Ensure anaerobic conditions during protein handling

    • Include glycerol (20-50%) in storage buffer to maintain stability

    • Avoid repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week

Challenge 3: Difficulties in functional assays

  • Problem: Quantifying cobalamin production in recombinant systems is challenging

  • Solutions:

    • Implement the quantitative cobalamin microbiological assay

    • Use LC-MS/MS for direct measurement of cobalamin and intermediates

    • Develop fluorescent or colorimetric reporter systems linked to cobalamin production

    • Employ genetic complementation assays in cobS-deficient strains

Challenge 4: Structural characterization limitations

  • Problem: Membrane-associated nature of cobS complicates structural studies

  • Solutions:

    • Generate truncated soluble domains for crystallization

    • Apply cryo-electron microscopy for full-length protein

    • Use computational modeling based on homologous proteins

    • Employ site-directed spin labeling with EPR for structural constraints

These methodological approaches have enabled successful expression and characterization of recombinant cobS, facilitating detailed investigations of cobalamin biosynthesis in Salmonella and related organisms .

What are the most promising future research areas involving recombinant Salmonella dublin cobS?

Several high-priority research directions involving recombinant Salmonella dublin cobS offer significant potential for scientific advancement:

Structural Biology Frontiers:

  • High-resolution structure determination of cobS using cryo-EM or X-ray crystallography

  • Mapping the conformational changes during catalysis using HDX-MS and smFRET

  • Computational modeling of substrate interactions and catalytic mechanism

Synthetic Biology Applications:

  • Engineering cobS variants with enhanced catalytic efficiency

  • Development of cobS-based biosensors for cobalamin and related metabolites

  • Integration of modified cobS into synthetic pathways for novel corrinoid production

Host-Pathogen Interaction Studies:

  • Investigation of cobS expression during infection using in vivo transcriptomics

  • Assessment of cobalamin biosynthesis contribution to colonization and persistence

  • Evaluation of cobS as a potential target for antimicrobial development

Evolutionary and Comparative Genomics:

  • Comprehensive analysis of cobS sequence and functional divergence across bacterial phyla

  • Reconstruction of cobalamin biosynthesis pathway evolution

  • Investigation of cobS gene horizontal transfer events

Connection with Antimicrobial Resistance:
Recent studies have identified distinct populations of S. Dublin with varying antimicrobial resistance profiles. In Australia, researchers discovered two distinct lineages containing a novel hybrid plasmid encoding both antimicrobial resistance and mercuric resistance. Understanding how metabolic pathways like cobalamin biosynthesis interact with these emerging resistance mechanisms represents a critical research direction with implications for pathogen control strategies .

These research directions collectively address fundamental scientific questions while offering potential practical applications in biotechnology, medicine, and agriculture.

How might understanding cobS function contribute to novel antimicrobial strategies against Salmonella dublin?

The critical role of cobS in Salmonella dublin metabolism presents several potential avenues for antimicrobial development:

Target-Based Antimicrobial Design:

  • Structure-based design of cobS inhibitors that disrupt cobalamin biosynthesis

  • Development of transition-state analogs specific to the cobS catalytic mechanism

  • Identification of allosteric inhibitors that prevent essential conformational changes

Pathway-Based Intervention Strategies:

  • Targeting multiple enzymes in the cobalamin biosynthetic pathway simultaneously

  • Creating "metabolic dead-ends" by inhibiting enzymes before cobS while overexpressing cobS

  • Developing compounds that redirect pathway intermediates into non-productive routes

Translational Potential:
The increasing prevalence of antimicrobial resistance in S. Dublin isolates underscores the need for novel therapeutic approaches. Recent characterization of S. Dublin isolates revealed multidrug resistance to numerous antibiotics, including ampicillin (87%), ceftiofur (89%), and sulfadimethoxine (97%). By targeting metabolic pathways that are absent in mammals, such as de novo cobalamin biosynthesis, researchers can potentially develop interventions with reduced side effects and cross-resistance .

Integration with Current Approaches:
Analysis of whole-genome sequencing data has revealed that the evolution of both core and accessory genomes in S. Dublin is geographical region-dependent. This suggests that antimicrobial strategies might need regional customization. Targeting conserved metabolic pathways like cobalamin biosynthesis could complement existing approaches while addressing the challenges posed by regionally distinct antimicrobial resistance profiles .

Biofilm Consideration:
Cobalamin availability influences biofilm formation in some bacterial species. Investigating whether cobS inhibition affects S. Dublin biofilm development could reveal additional therapeutic applications, particularly for persistent infections associated with biofilm formation on medical devices or host tissues.

These approaches represent promising directions for addressing the growing challenge of antimicrobial-resistant S. Dublin infections, which pose significant risks to both animal and human health .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.