Recombinant Salmonella dublin Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella dublin Electron Transport Complex Protein RnfE (rnfE)

Recombinant Salmonella dublin Electron Transport Complex Protein RnfE (rnfE) is a bacterially expressed protein engineered to replicate the native RnfE subunit of the Rnf (Rhodobacter nitrogen fixation) electron transport complex. This protein plays a critical role in redox reactions, ion translocation, and energy metabolism in Salmonella dublin, a cattle-adapted pathogen associated with systemic infections . Recombinant production enables biochemical and functional studies of this protein, which is implicated in bacterial virulence and survival .

Gene Context

  • Gene Name: rnfE (synonyms: rsxE, SeD_A1883) .

  • Function: Part of the Rnf complex, which facilitates electron transfer between NADH and ferredoxin, coupled with ion (H⁺/Na⁺) translocation .

Production and Purification

The recombinant protein is synthesized via heterologous expression in E. coli, followed by affinity chromatography using the His tag . Key steps include:

  1. Cloning: The rnfE gene (1-230aa) is fused to an N-terminal His tag.

  2. Expression: Induced in E. coli under optimized conditions.

  3. Purification: Immobilized metal-ion chromatography (IMAC) ensures high purity (>90%) .

  4. Quality Control: Verified by SDS-PAGE and mass spectrometry .

Role in Bacterial Metabolism

  • The Rnf complex in Salmonella dublin is essential for maintaining redox balance and ATP synthesis under anaerobic conditions .

  • RnfE contributes to the structural integrity of the multi-subunit complex, which includes RnfA, RnfB, RnfC, RnfD, and RnfG .

Association with Pathogenicity

  • Comparative genomic studies highlight the conservation of RnfE across Salmonella serovars, suggesting evolutionary importance in host adaptation .

  • In S. dublin, electron transport proteins like RnfE may indirectly influence virulence by modulating energy metabolism during infection .

Applications in Research

  1. Antimicrobial Resistance (AMR) Studies: Used to investigate links between electron transport efficiency and resistance mechanisms (e.g., bla CMY-2, tet(A)) .

  2. Structural Biology: Supports crystallography or cryo-EM studies to resolve the Rnf complex’s architecture .

  3. Vaccine Development: Potential antigen candidate due to surface exposure in pathogenic strains .

Comparative Analysis with Related Proteins

ProteinOrganismKey DomainsFunction
RnfESalmonella dublinElectron transport RsxEIon translocation, redox balance
RnfASalmonella dublinRsx electron transportNADH dehydrogenase activity
RHS-HNHcSalmonella dublinHNHc endonucleaseDNAse activity in T6SS effectors

Research Challenges and Future Directions

  • Functional Redundancy: Overlapping roles of Rnf subunits complicate targeted inhibition .

  • Structural Dynamics: Mechanistic details of ion translocation remain unresolved .

  • Therapeutic Potential: Exploring RnfE as a target for disrupting bacterial energy metabolism .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
rsxE; SeD_A1888; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLARLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is part of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is crucial for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Electron transport complex protein RnfE in Salmonella Dublin?

The RnfE protein (also known as rsxE) is a critical component of the electron transport system in Salmonella Dublin. It functions as part of the ion-translocating oxidoreductase complex, playing an essential role in the bacterium's respiratory chain. The protein consists of 230 amino acids and is characterized by its transmembrane structure, contributing to energy metabolism in this pathogenic organism . As noted in its UniProt entry (B5FIF0), RnfE is also referred to as "Rsx electron transport complex subunit E" and participates in electron flow management across the bacterial membrane .

What are the recommended approaches for expressing and purifying recombinant RnfE protein?

For recombinant expression of Salmonella Dublin RnfE, a heterologous E. coli expression system is the preferred approach. The methodology typically involves:

  • Gene synthesis or PCR amplification of the rsxE gene (with appropriate restriction sites)

  • Cloning into an expression vector with an N-terminal His-tag

  • Transformation into an E. coli expression strain

  • Induction of protein expression (commonly with IPTG)

  • Cell lysis and membrane fraction isolation

  • Solubilization of membrane proteins using appropriate detergents

  • Affinity purification using Ni-NTA or similar His-tag binding resins

  • Size exclusion chromatography for final purification

The resulting protein should be maintained in a detergent-stabilized form to preserve structure and activity . When expressing membrane proteins like RnfE, it's critical to optimize expression conditions to prevent protein aggregation and inclusion body formation.

How should recombinant RnfE protein be stored and reconstituted for experimental use?

Optimal storage and reconstitution of recombinant RnfE protein involves:

Storage recommendations:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • For short-term storage, working aliquots can be kept at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

The storage buffer used for commercial preparations typically consists of Tris/PBS-based buffer with 6% trehalose, at pH 8.0 . This formulation helps maintain protein stability during storage.

What analytical methods can be used to verify RnfE protein identity and activity?

Several analytical approaches are recommended for RnfE protein characterization:

  • SDS-PAGE analysis: To confirm protein size (~36 kDa without tags) and >90% purity

  • Western blotting: Using anti-His antibodies or specific anti-RnfE antibodies

  • Mass spectrometry: For precise molecular weight determination and peptide fingerprinting

  • Circular dichroism: To assess secondary structure elements

  • Electron transport activity assays: Measuring electron transfer using appropriate substrates and electron acceptors

  • Reconstitution into liposomes: For functional studies of membrane transport properties

For structural studies, techniques such as cryo-electron microscopy may be employed after optimization of protein stability in detergent micelles or nanodiscs.

How can RnfE be utilized in genomic studies of Salmonella Dublin pathogenicity?

For genomic studies examining RnfE's role in pathogenicity:

  • Comparative genomics approach: Analyze the conservation and variation of the rsxE gene across Salmonella Dublin isolates from different sources and outbreak events. This can be achieved through whole genome sequencing (WGS) and phylogenomic analysis as described for other Salmonella Dublin genomic studies .

  • Transcriptomic analysis: Examine rsxE expression patterns under various conditions mimicking host environments to understand regulatory networks.

  • Mutagenesis studies: Create targeted gene knockouts or mutations in rsxE using techniques similar to those described for sopD mutations:

    • Design PCR primers based on the gene sequence

    • Clone into suicide plasmid vectors (e.g., pDM4)

    • Perform conjugation and selection for transconjugants

    • Confirm insertion through PCR verification

  • Complementation studies: Reintroduce the wild-type gene on a plasmid to confirm phenotype restoration, similar to the transcomplementation approach used for sopD studies .

What role might RnfE play in Salmonella Dublin adaptation to different environments?

As an electron transport complex component, RnfE likely contributes significantly to Salmonella Dublin's adaptability across diverse environments:

  • Host intestinal adaptation: RnfE may facilitate adaptation to the anaerobic or microaerobic conditions of the intestinal environment by supporting alternative electron transport pathways.

  • Environmental persistence: The protein could enable metabolic flexibility when Salmonella Dublin exists outside host organisms, potentially contributing to survival in food products, agricultural settings, or water systems.

  • Stress response mechanisms: RnfE might be involved in the bacterium's response to oxidative stress, pH fluctuations, and nutrient limitation—all conditions encountered during infection and environmental transmission.

Research investigating these adaptive roles would benefit from experimental designs comparing wild-type strains with rsxE mutants under various environmental conditions, measuring growth rates, metabolic outputs, and stress response biomarkers .

How does RnfE interact with other components of the electron transport system in Salmonella Dublin?

The electron transport complex containing RnfE operates as a multiprotein assembly. Research approaches to study these interactions include:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using tagged RnfE

    • Bacterial two-hybrid systems

    • Crosslinking followed by mass spectrometry

  • Structural biology approaches:

    • Cryo-electron microscopy of the entire complex

    • X-ray crystallography of component subcomplexes

    • Molecular dynamics simulations based on structural data

  • Functional reconstitution:

    • Reconstitution of purified components into liposomes

    • Measurement of electron transport activity with varying complex compositions

The complete Rnf/Rsx complex typically contains several subunits (RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG), with RnfE serving as a critical membrane-embedded component that facilitates electron transfer across the membrane .

How can RnfE be utilized in developing diagnostic tools for Salmonella Dublin?

While current diagnostic approaches for Salmonella Dublin primarily target other genetic markers, RnfE could potentially serve as an additional diagnostic target:

  • PCR-based detection: Design of primers specific to the rsxE gene region unique to Salmonella Dublin could enhance specificity of detection assays. This approach could complement existing methods such as the XP-Design Assay for Salmonella Dublin, which targets other DNA sequences specific to this serotype .

  • Immunological detection: Development of antibodies against unique epitopes of the RnfE protein could enable immunoassay-based detection methods.

  • Biosensor development: RnfE-specific aptamers or antibody fragments could be integrated into biosensor platforms for rapid detection.

The XP-Design Assay for Salmonella Dublin represents a model diagnostic approach, demonstrating high specificity when tested against 94 strains, representing 54 serotypes or lineages of Salmonella enterica subsp. enterica and 27 non-Salmonella bacterial species .

What are the current methods for detecting Salmonella Dublin in research and clinical samples?

Current detection methodologies for Salmonella Dublin include:

Cultural methods:

  • Growth on selective and differential media

  • Biochemical confirmation tests

  • Serological typing

Molecular detection:

  • PCR-based assays targeting Salmonella Dublin-specific sequences

  • Real-time PCR using TaqMan probes (e.g., XP-Design Assay Salmonella Dublin)

  • Whole genome sequencing for definitive identification and strain typing

Protocol overview for XP-Design Assay Salmonella Dublin:

For isolated colonies:

  • Grow Salmonella colonies on nonselective agar plates

  • Extract DNA following established protocols

  • Perform real-time PCR using FAM-labeled probes

  • Analyze results using appropriate thermal cycler protocols

For food and environmental samples:

  • Enrich samples according to established protocols (e.g., iQ-Check Salmonella spp. II User Guide)

  • Extract DNA using the Easy protocol

  • Perform real-time PCR

  • Interpret results against appropriate controls

This assay demonstrates high specificity and a limit of detection similar to the iQ-Check Salmonella II method, with an efficiency of 101% .

How does RnfE compare structurally and functionally across different Salmonella serotypes?

A comparative analysis of RnfE across Salmonella serotypes reveals important evolutionary and functional insights:

SerotypeProtein LengthSequence Identity to S. Dublin RnfEKey Functional Domains
S. Dublin230 aa100%Transmembrane segments, electron transport motifs
S. Typhimurium230 aa>95%Conserved functional domains with minor variations
Other Salmonella enterica230-232 aa90-97%Highly conserved functional regions

The high degree of conservation across serotypes (>95% identity between S. Dublin and S. Typhimurium) suggests the critical importance of RnfE in Salmonella biology . Despite this conservation, subtle amino acid differences might contribute to serotype-specific metabolic adaptations or host preferences. Comparative functional studies could explore whether these minor variations correlate with differences in electron transport efficiency, antimicrobial resistance, or environmental persistence.

What are the challenges in studying membrane proteins like RnfE compared to cytoplasmic proteins?

Membrane proteins like RnfE present unique research challenges:

  • Expression difficulties:

    • Toxicity to expression hosts when overexpressed

    • Proper membrane insertion requirements

    • Potential for inclusion body formation

  • Purification complexities:

    • Need for detergents or membrane-mimetic systems

    • Protein stability issues outside the membrane environment

    • Lower yields compared to soluble proteins

  • Functional assessment limitations:

    • Difficulty in reconstituting native membrane environment

    • Challenges in measuring activity when removed from the membrane

    • Complex interactions with other membrane components

  • Structural analysis obstacles:

    • Challenges in crystallization for X-ray diffraction

    • Size limitations for NMR studies

    • Special requirements for cryo-EM sample preparation

Researchers can address these challenges through specialized techniques such as detergent screening, lipid nanodisc reconstitution, and the use of membrane-mimetic systems for functional studies .

How can phylogenomic approaches be applied to understand the evolution of electron transport proteins in Salmonella Dublin?

Phylogenomic approaches offer powerful tools for understanding RnfE evolution:

  • Whole genome sequencing and analysis:

    • Collect genomic data from diverse Salmonella Dublin isolates

    • Apply phylogenetic signal analysis accounting for homologous recombination events

    • Correlate phylogenomic clustering with isolation date, matrices, and geographical origin

  • Phylogeographic analysis:

    • Examine the geographical distribution of RnfE variants

    • Identify potential association between specific variants and outbreak events

    • Map evolutionary changes to particular environmental niches or hosts

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Identify conserved domains that may be essential for function

    • Detect regions of potential adaptive evolution

Researchers have successfully applied such approaches to understand Salmonella Dublin strain dynamics over multiple years, revealing the genesis of outbreak events and establishing epidemiological relationships. These methods can similarly be applied to study the evolution of electron transport proteins specifically .

What potential exists for targeting RnfE in antimicrobial development?

As an essential component of electron transport, RnfE presents several opportunities for antimicrobial development:

  • Small molecule inhibitors:

    • Design of compounds that specifically bind to critical functional regions of RnfE

    • Development of inhibitors that disrupt protein-protein interactions within the complex

    • Creation of molecules that block electron transfer pathways

  • Peptide-based inhibitors:

    • Design of peptides that mimic interaction interfaces

    • Development of cell-penetrating antimicrobial peptides targeting RnfE function

  • Evaluation criteria for potential RnfE inhibitors:

    • Specificity for bacterial RnfE over host electron transport components

    • Ability to penetrate the bacterial outer membrane

    • Low potential for resistance development

    • Minimal disruption to beneficial microbiota

The conserved nature of RnfE across Salmonella strains makes it a potentially valuable target for broad-spectrum agents against this pathogen .

How might CRISPR-Cas9 technology be applied to study RnfE function in Salmonella Dublin?

CRISPR-Cas9 technology offers precise genetic manipulation approaches for RnfE functional studies:

  • Gene knockout strategies:

    • Design of guide RNAs targeting the rsxE gene

    • Creation of complete gene deletions or functional disruptions

    • Development of conditional knockout systems for essential genes

  • Site-directed mutagenesis:

    • Introduction of specific point mutations to study structure-function relationships

    • Modification of potential active sites or protein-protein interaction domains

    • Creation of tagged versions for localization studies

  • Transcriptional modulation:

    • Use of CRISPR interference (CRISPRi) to downregulate rsxE expression

    • Application of CRISPR activation (CRISPRa) to upregulate expression

    • Temporal control of expression using inducible CRISPR systems

These approaches would complement traditional mutagenesis methods like those used for studying other Salmonella proteins, where DNA fragments are amplified, cloned into suicide plasmids, and introduced through conjugation or P22 transduction .

What interdisciplinary approaches could advance our understanding of RnfE's role in Salmonella Dublin pathogenesis?

Advancing RnfE research requires integrative approaches combining:

  • Systems biology:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Network analysis of electron transport pathways

    • Computational modeling of energy metabolism during infection

  • Structural biology and biophysics:

    • Cryo-EM studies of the complete electron transport complex

    • Single-molecule biophysics to measure electron transfer rates

    • Molecular dynamics simulations of membrane protein interactions

  • Infection biology:

    • Animal models to assess the impact of RnfE mutations on virulence

    • Cell culture systems to study host-pathogen interactions

    • Organ-on-chip technologies to model complex host environments

  • Synthetic biology:

    • Creation of minimal Salmonella systems with engineered electron transport chains

    • Development of biosensors based on RnfE function

    • Design of attenuated strains with modified RnfE for vaccine development

These interdisciplinary approaches would build upon established methodologies for studying Salmonella pathogenesis, such as the use of ligated intestinal loop models that have proven valuable for examining the roles of secreted effector proteins in enteropathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.