Recombinant Salmonella dublin Fumarate reductase subunit C (frdC)

What is Fumarate reductase subunit C (frdC) in Salmonella dublin?

Fumarate reductase subunit C (frdC) is a 15 kDa hydrophobic protein that functions as an integral component of the fumarate reductase complex in Salmonella dublin. The protein is encoded by the frdC gene (locus tag SeD_A4738) and has a full amino acid sequence of 131 residues: MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPTVWFSIELIFGLFALKH GAESWMGFVGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALFW . The protein is characterized as a membrane-anchoring subunit that helps position the catalytic components of the enzyme complex within the bacterial membrane, facilitating electron transport processes essential for anaerobic respiration.

What is the functional role of frdC in Salmonella dublin metabolism?

The frdC protein serves as a critical component in anaerobic respiration pathways of Salmonella dublin, particularly when oxygen is limited. The fumarate reductase complex catalyzes the conversion of fumarate to succinate, which is the reverse reaction of that catalyzed by succinate dehydrogenase in the tricarboxylic acid (TCA) cycle. This process is essential for:

• Energy generation under anaerobic conditions

• Maintenance of redox balance

• Utilization of alternative electron acceptors when oxygen is unavailable

Research indicates that succinate utilization, which is closely linked to fumarate reductase activity, is tightly regulated in Salmonella and plays a role in colonization of the inflamed gut but not in intra-macrophage proliferation . The complex regulatory systems controlling succinate metabolism suggest that these pathways are crucial for niche-specific adaptation during infection.

How does frdC expression affect Salmonella dublin virulence?

FrdC expression contributes to Salmonella dublin virulence through multiple mechanisms:

• Anaerobic adaptation: By enabling growth under the low-oxygen conditions found in the intestinal environment

• Metabolic flexibility: Allowing the pathogen to utilize alternative energy sources during infection

• Host niche colonization: Supporting bacterial persistence in specific tissues, particularly in calves where S. Dublin infections show higher severity

The expression of frdC appears to be controlled by multiple regulatory systems, including the global stress response regulator RpoS (σ38), which represses the sdhCDAB operon and other TCA cycle genes under certain conditions . This regulation ensures that succinate utilization occurs only in appropriate infection niches, contributing to Salmonella dublin's adaptability during pathogenesis.

What methods are optimal for recombinant frdC expression and purification?

Expression System Selection:

For recombinant Salmonella dublin frdC expression, the following approaches have proven effective:

• E. coli-based expression systems:

  • BL21(DE3) strain with pET vector systems for high-yield expression

  • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Fusion tags (His6, GST, or MBP) to facilitate purification and potentially improve solubility

Purification Protocol:

Validation Steps:

• SDS-PAGE analysis for purity assessment

• Western blot using anti-His or specific anti-frdC antibodies

• Mass spectrometry to confirm protein identity and integrity

How can researchers design experiments to study frdC function in vitro?

Enzymatic Activity Assays:

To measure fumarate reductase activity involving frdC:

• Spectrophotometric assays: Monitor the oxidation of reduced benzyl viologen at 578 nm, which couples to fumarate reduction

• Oxygen consumption: Using oxygen electrodes to measure respiratory activity

• Succinate production: Quantify by high-performance liquid chromatography (HPLC)

Membrane Integration Studies:

• Proteoliposome reconstitution: Incorporate purified frdC into artificial lipid bilayers

• Patch-clamp techniques: Measure membrane potential changes

• Fluorescence-based assays: Using environment-sensitive probes to assess membrane insertion

Mutation Analysis Protocol:

• Design site-directed mutations targeting conserved residues in the transmembrane regions

• Express wild-type and mutant proteins under identical conditions

• Compare protein stability, membrane integration, and functional activity

• Correlate structure-function relationships based on mutation effects

How does frdC contribute to antibiotic resistance mechanisms in Salmonella dublin?

Recent research indicates that Salmonella dublin isolates show alarming patterns of multidrug resistance, with susceptibility data indicating resistance to multiple antibiotic classes including ampicillin (87%), ceftiofur (89%), chlortetracycline (94%), oxytetracycline (94%), florfenicol (94%), and sulfadimethoxine (97%) . While frdC itself is not an antibiotic resistance determinant, its role in energy metabolism under stress conditions may indirectly contribute to resistance mechanisms through:

• Metabolic adaptation: FrdC-mediated anaerobic respiration may support bacterial persistence during antibiotic exposure

• Energy-dependent efflux: By providing ATP for efflux pump activity

• Biofilm formation: Supporting metabolic activities in biofilm communities that confer protection against antibiotics

Experimental approach to investigate frdC involvement in resistance:

• Generate frdC knockout mutants in Salmonella dublin

• Determine minimum inhibitory concentrations (MICs) for various antibiotics in wild-type vs. mutant strains

• Measure expression levels of frdC during antibiotic exposure using qRT-PCR

• Assess metabolic profiles during antibiotic stress using metabolomics approaches

What is the relationship between succinate metabolism and frdC regulation in Salmonella dublin?

The regulation of succinate metabolism in Salmonella involves multiple interconnected systems that likely impact frdC expression:

• The stress response sigma factor RpoS (σ38) inhibits growth on succinate by repressing transcription of the sdhCDAB operon and other TCA cycle genes

• The CspC RNA binding protein restricts succinate utilization, which can be antagonized by high levels of the small regulatory RNA OxyS

• The Fe-S cluster regulatory protein IscR inhibits succinate utilization by repressing the C4-dicarboxylate transporter DctA

• The ribose operon repressor RbsR is required for complete RpoS-driven repression of succinate utilization

Proposed experimental workflow to study frdC regulation:

• Construct reporter fusions (frdC promoter with fluorescent protein)

• Analyze expression under various environmental conditions (oxygen levels, pH, nutrient availability)

• Test expression in regulatory mutants (ΔrpoS, ΔcspC, ΔiscR, ΔrbsR)

• Identify direct regulators using chromatin immunoprecipitation (ChIP)

• Validate findings using in vivo infection models

How can genomic analysis inform the evolution of frdC in different Salmonella serovars?

Core-genome analysis of Salmonella Dublin isolates has revealed important insights into strain diversity and evolution . Similar approaches can be applied specifically to frdC:

Comparative genomic analysis workflow:

• Obtain frdC sequences from diverse Salmonella serovars

• Perform multiple sequence alignment to identify conserved and variable regions

• Calculate nucleotide diversity (π) and selection pressure (dN/dS) across the gene

• Identify potential recombination events using methods like RDP4

• Construct phylogenetic trees to visualize evolutionary relationships

Expected outcomes:

• Identification of serovar-specific adaptations in frdC sequence

• Assessment of evolutionary conservation suggesting functional importance

• Detection of horizontal gene transfer events that might have shaped frdC evolution

What methodologies are effective for studying frdC protein-protein interactions?

Understanding the protein interaction network of frdC is crucial for elucidating its role in fumarate reductase complex assembly and function:

Recommended techniques:

• Bacterial two-hybrid system:

  • Transform bacterial cells with plasmids expressing frdC and potential interacting partners fused to complementary fragments of a reporter protein

  • Screen for positive interactions by monitoring reporter activity

  • Validate using co-immunoprecipitation

• Crosslinking mass spectrometry:

  • Treat intact bacteria or membrane fractions with crosslinking agents

  • Digest proteins and enrich for crosslinked peptides

  • Identify interacting partners by tandem mass spectrometry

  • Map interaction sites at the amino acid resolution

• Blue native PAGE:

  • Solubilize membrane complexes using mild detergents

  • Separate intact protein complexes by native gel electrophoresis

  • Identify components by second-dimension SDS-PAGE or mass spectrometry

Data analysis and interpretation:

• Network visualization using tools like Cytoscape

• Functional annotation of interacting partners

• Correlation with other datasets (transcriptomics, phenotypic assays)

How can recombinant frdC be utilized in the development of diagnostic tools for Salmonella dublin?

Recombinant frdC protein has potential applications in developing sensitive and specific diagnostic tools for Salmonella dublin, particularly in veterinary settings where rapid detection is crucial:

ELISA-based detection system:

• Coat microplate wells with purified recombinant frdC (50 μg/mL)

• Block non-specific binding sites with BSA or casein

• Add test samples (serum, milk, or tissue homogenates)

• Detect bound antibodies using species-appropriate labeled secondary antibodies

• Develop and quantify signal

Performance optimization strategies:

• Determine optimal antigen concentration and coating conditions

• Evaluate cross-reactivity with antibodies against other Salmonella serovars

• Assess sensitivity and specificity using known positive and negative samples

• Validate against gold standard methods (bacterial culture, PCR)

Given the increasing prevalence of Salmonella Dublin in dairy cattle and its zoonotic potential , development of rapid diagnostic tests using recombinant proteins like frdC could significantly improve surveillance and control efforts.

What approaches can be used to evaluate frdC as a potential vaccine candidate?

Evaluating frdC as a potential vaccine antigen requires a systematic approach:

Immunogenicity assessment protocol:

• Animal immunization studies:

  • Immunize mice with purified recombinant frdC using appropriate adjuvants

  • Collect sera at different time points post-immunization

  • Measure antibody titers by ELISA

  • Assess T-cell responses by ELISpot or flow cytometry

• Epitope mapping:

  • Generate peptide arrays covering the frdC sequence

  • Identify B-cell and T-cell epitopes using sera from immunized animals

  • Focus on conserved epitopes across Salmonella strains

• Protection studies:

  • Challenge immunized animals with virulent Salmonella dublin

  • Monitor bacterial load in tissues, clinical signs, and survival

  • Compare with established vaccine antigens as positive controls

Given that Salmonella Dublin infections predominantly affect calves (38 times more likely than adults) and often present with respiratory symptoms, an effective vaccine would target this vulnerable population and potentially reduce the need for antimicrobial treatments, which is particularly important considering the high rates of multidrug resistance observed (ampicillin 87%, ceftiofur 89%, chlortetracycline 94%) .

What are common challenges in producing functional recombinant frdC and how can they be addressed?

The production of functional recombinant membrane proteins like frdC presents several technical challenges:

Challenge 1: Protein toxicity during expression

• Solution: Use tightly controlled inducible systems (e.g., pBAD with arabinose induction)

• Solution: Lower induction temperature (16-18°C)

• Solution: Reduce inducer concentration and extend expression time

Challenge 2: Inclusion body formation

• Solution: Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

• Solution: Use fusion partners that enhance solubility (MBP, SUMO)

• Solution: Optimize growth media composition (reduced glucose, supplemented glycylglycine)

Challenge 3: Poor membrane integration

• Solution: Use specialized strains with enhanced membrane protein expression capacity

• Solution: Include appropriate signal sequences for membrane targeting

• Solution: Supplement growth media with phospholipids

Challenge 4: Protein instability during purification

• Solution: Screen multiple detergents for optimal solubilization

• Solution: Add stabilizing agents (glycerol, specific lipids)

• Solution: Maintain cold temperatures throughout purification

• Solution: Include protease inhibitors in all buffers

Challenge 5: Loss of activity post-purification

• Solution: Reconstitute into proteoliposomes or nanodiscs

• Solution: Add cofactors or stabilizing ligands during storage

• Solution: Store at -20°C or -80°C in 50% glycerol to prevent freeze-thaw damage

How can researchers validate the structural integrity of recombinant frdC?

Ensuring that recombinant frdC maintains its native structure is essential for functional studies:

Structural validation methods:

• Circular Dichroism (CD) Spectroscopy:

  • Measure far-UV CD spectra (190-260 nm) to assess secondary structure content

  • Compare with predicted secondary structure based on sequence analysis

  • Analyze thermal stability by monitoring CD signal during temperature ramping

• Tryptophan Fluorescence:

  • Exploit the presence of tryptophan residues in frdC sequence (MTTKRKPYVRPMTSTWWKKLPFYRFYMLREG...)

  • Monitor emission spectra (310-400 nm) after excitation at 280 nm

  • Changes in spectra indicate alterations in the local environment of tryptophan residues

• Limited Proteolysis:

  • Treat purified frdC with controlled amounts of proteases

  • Analyze digestion patterns by SDS-PAGE and mass spectrometry

  • Compare with predicted digestion sites in properly folded protein

• Antibody Recognition:

  • Generate conformation-specific antibodies

  • Test binding by ELISA or Western blot

  • Reduced binding suggests structural alterations

• Functional Assays:

  • Measure electron transfer capability in reconstituted systems

  • Assess interaction with other components of the fumarate reductase complex

  • Compare activity with native protein isolated from Salmonella

How might systems biology approaches enhance our understanding of frdC in Salmonella dublin pathogenesis?

Integrating frdC research into systems biology frameworks offers opportunities to understand its role in the broader context of Salmonella dublin metabolism and virulence:

Multi-omics integration strategies:

• Transcriptomics + Proteomics:

  • Compare frdC gene and protein expression across infection models

  • Identify co-regulated genes and proteins

  • Build regulatory networks centered on frdC expression

• Metabolomics + Fluxomics:

  • Measure metabolite levels and fluxes in wild-type vs. frdC mutants

  • Quantify changes in succinate, fumarate, and related metabolites

  • Model metabolic adaptations during host colonization

• In vivo imaging + Spatial transcriptomics:

  • Track frdC expression in different host tissues

  • Correlate with bacterial distribution and host responses

  • Identify niche-specific regulation patterns

Since research indicates that farm-level management practices account for 92% of unexplained variance in Salmonella Dublin infection risk , systems approaches that integrate bacterial metabolism with host and environmental factors could provide crucial insights for developing effective control strategies.

What is the potential of CRISPR-Cas technologies in studying frdC function?

CRISPR-Cas systems offer powerful tools for precise genetic manipulation of frdC:

CRISPR-based experimental approaches:

• Knockout/knockdown studies:

  • Generate clean frdC deletions without polar effects on operonic genes

  • Create conditional knockdowns using CRISPRi to study essential functions

  • Design multiplexed knockouts to study genetic redundancy

• Base editing applications:

  • Introduce specific amino acid substitutions without double-strand breaks

  • Target conserved residues to assess functional importance

  • Create libraries of point mutations for structure-function analysis

• CRISPRa for overexpression studies:

  • Upregulate frdC expression to assess metabolic consequences

  • Test effects on antibiotic resistance phenotypes

  • Evaluate impact on virulence in infection models

• In vivo tracking:

  • Tag endogenous frdC with fluorescent reporters

  • Monitor expression dynamics during infection

  • Correlate with bacterial localization in host tissues

Given the tight regulation of succinate utilization by multiple systems in Salmonella , CRISPR technologies could help dissect the complex regulatory networks controlling frdC expression and function, potentially revealing new targets for antimicrobial development.