Recombinant Salmonella dublin Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

1. Introduction to Recombinant Salmonella dublin Glycerol-3-Phosphate Acyltransferase (PlsY)

Recombinant Salmonella dublin Glycerol-3-phosphate acyltransferase (PlsY) is a bacterially expressed protein engineered to study lipid biosynthesis pathways in Salmonella and related pathogens. This enzyme catalyzes the transfer of an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate (G3P), initiating phospholipid biosynthesis . Its recombinant form, fused with a polyhistidine (His) tag, enables purification and functional characterization .

2. Molecular and Biochemical Characteristics

Vaccine Development

  • Recombinant PlsY serves as an antigen candidate for Salmonella vaccine development due to its surface-exposed epitopes and role in virulence .

  • Evaluated in preclinical models for immunogenicity and protective efficacy against systemic salmonellosis .

Antimicrobial Resistance Studies

  • PlsY is implicated in lipid remodeling under antibiotic stress, as observed in multidrug-resistant S. dublin ST10 strains carrying hybrid plasmids .

  • Genomic analyses link plsY conservation across Salmonella serovars, highlighting its evolutionary stability despite plasmid-mediated AMR gene acquisition .

5. Comparative Genomic and Plasmid Analysis

Recent studies of S. dublin isolates reveal:

FeatureST10 Lineage (Predominant)ST74 Lineage (Minor)
Plasmid RepliconsIncX1 (97.4%), IncFII(S) (93.1%) Distinct from ST10
spv OperonPresent on virulence plasmids Absent in some hybrid plasmids
AMR GenesLinked to IncC/IncX1 megaplasmids Rare

The plsY gene is chromosomally encoded and conserved across lineages, underscoring its essential metabolic role .

6. Challenges and Future Directions

  • Structural Characterization: No high-resolution structure of S. dublin PlsY exists; homology modeling using B. subtilis Lit (PDB: 7KJX) is ongoing .

  • Antibiotic Targeting: PlsY’s role in lipid biosynthesis makes it a potential target for novel antibiotics, though its membrane localization complicates drug design .

  • Epidemiological Monitoring: Tracking plsY mutations in emerging MDR S. dublin strains could reveal adaptive mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage condition, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; ygiH; SeD_A3563; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor but not acyl-PO(4).
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in Salmonella dublin?

Glycerol-3-phosphate acyltransferase (plsY) is a crucial enzyme involved in phospholipid biosynthesis in bacteria. In Salmonella dublin, plsY (also known as ygiH or SeD_A3563) functions as a lysophosphatidic acid synthase that catalyzes the transfer of an acyl group to glycerol-3-phosphate, forming lysophosphatidic acid—a critical intermediate in membrane phospholipid synthesis . The enzyme is essential for bacterial membrane integrity and cellular function. The full-length protein consists of 203 amino acids and is encoded by the plsY gene in Salmonella dublin .

How is recombinant plsY typically expressed and purified for research purposes?

Recombinant Salmonella dublin plsY is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The protein can be expressed as a full-length construct (1-203 amino acids) and purified to >90% purity as determined by SDS-PAGE .

For optimal expression and purification:

  • Transform expression plasmid into E. coli host strains

  • Induce protein expression (typically with IPTG for T7-based systems)

  • Lyse cells and purify using nickel affinity chromatography leveraging the His-tag

  • Further purify by size exclusion chromatography if higher purity is required

  • Lyophilize or store in appropriate buffer with cryoprotectants

The resulting purified protein can be stored as a lyophilized powder or in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal storage and handling conditions for recombinant plsY?

For optimal stability and activity of recombinant Salmonella dublin plsY:

Storage ConditionRecommendation
Long-term storageStore at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles
Working stockStore at 4°C for up to one week
Buffer compositionTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionReconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL
CryoprotectionAdd glycerol to a final concentration of 5-50% (optimally 50%)
HandlingCentrifuge vials briefly before opening to bring contents to the bottom

Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of enzymatic activity .

How can researchers verify the expression and activity of recombinant plsY?

Verification of recombinant plsY expression and activity should involve multiple approaches:

  • Expression verification:

    • SDS-PAGE analysis to confirm protein size (expected ~23 kDa plus tag size)

    • Western blot using anti-His antibodies or specific anti-plsY antibodies

    • Mass spectrometry for precise identification

  • Activity assessment:

    • Enzymatic assays measuring the transfer of acyl groups to glycerol-3-phosphate

    • Monitoring lysophosphatidic acid formation using thin-layer chromatography or HPLC

    • Coupled enzyme assays that detect products of the acyltransferase reaction

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate proper folding

    • Thermal shift assays to determine stability

Similar verification methods have been successfully applied to other recombinant proteins expressed in Salmonella systems, such as immunoblotting techniques used to detect secreted recombinant proteins in both cell lysates and culture supernatants .

What approaches can be used to study plsY's role in Salmonella dublin pathogenesis?

To investigate plsY's contribution to Salmonella dublin pathogenesis:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 gene editing to create plsY deletion mutants

    • Inducible antisense RNA to create conditional knockdowns

    • Complementation studies to confirm phenotype specificity

  • Virulence assessment:

    • Animal infection models (e.g., calf models for Salmonella dublin)

    • Cell invasion assays using relevant host cell types

    • Bacterial survival in macrophages or other immune cells

    • Competitive index experiments comparing wild-type and plsY mutants

  • Membrane integrity analysis:

    • Phospholipid composition analysis by mass spectrometry

    • Membrane permeability assays

    • Antibiotic susceptibility profiling

  • Host-pathogen interaction studies:

    • Immunofluorescence microscopy to track bacterial localization

    • Transcriptomics to assess host response to wild-type vs. plsY mutants

    • Metabolomics to identify altered metabolic pathways

Such approaches would build upon established methodologies used in studying other Salmonella dublin virulence factors, including those examined in attenuated strains like SL5631 .

What are common challenges in expressing and purifying active recombinant plsY?

Researchers frequently encounter several challenges when working with recombinant plsY:

ChallengePotential Solutions
Low expression levels- Optimize codon usage for expression host
- Test different promoters and induction conditions
- Consider fusion tags that enhance solubility (e.g., MBP, SUMO)
- Evaluate alternative E. coli strains
Protein insolubility- Express at lower temperatures (16-25°C)
- Reduce inducer concentration
- Use specialized E. coli strains for membrane proteins
- Add solubilizing agents during lysis
Purification difficulties- Optimize imidazole concentrations in binding/washing/elution buffers
- Include mild detergents for membrane protein solubilization
- Consider on-column refolding protocols
- Test alternative affinity tags
Loss of activity- Include protease inhibitors during purification
- Minimize time at room temperature
- Identify and maintain essential cofactors
- Consider purification under anaerobic conditions
Aggregation during storage- Optimize buffer composition with stabilizers like trehalose
- Determine optimal protein concentration
- Aliquot to avoid freeze-thaw cycles
- Consider addition of reducing agents

How can researchers distinguish between native and recombinant plsY activity in experimental systems?

Differentiating native from recombinant plsY activity requires careful experimental design:

  • Tagging strategies:

    • Use epitope tags (His, FLAG, HA) on recombinant plsY that allow specific detection

    • Develop tag-specific activity assays that selectively measure recombinant enzyme

  • Expression control:

    • Use inducible promoters to control recombinant plsY expression

    • Compare activity before and after induction

    • Quantify expression levels by Western blot to correlate with activity

  • Selective inhibition:

    • Design inhibitors specific to recombinant plsY (e.g., tag-binding inhibitors)

    • Use genetic approaches to selectively inhibit native or recombinant plsY

  • Kinetic discrimination:

    • Characterize and compare kinetic parameters of native and recombinant enzymes

    • Identify substrate concentration ranges where one form predominates

    • Use modified substrates that preferentially interact with one form

  • Background elimination:

    • Express recombinant plsY in plsY-knockout backgrounds

    • Use heterologous expression systems lacking endogenous plsY activity

What are the implications of plsY sequence variations across different Salmonella strains?

Sequence variations in plsY across Salmonella strains can have significant implications:

  • Functional consequences:

    • Altered substrate specificity affecting phospholipid composition

    • Changes in enzyme efficiency impacting membrane biosynthesis rates

    • Modified regulation of enzyme activity

    • Variations in protein stability and cellular localization

  • Evolutionary significance:

    • Insights into adaptation to different host environments

    • Understanding selective pressures on membrane composition

    • Identification of conserved catalytic residues versus variable regions

  • Experimental design considerations:

    • Strain-specific optimization of expression and purification protocols

    • Need for strain-specific activity assays and antibodies

    • Caution when extrapolating findings between strains

  • Therapeutic targeting:

    • Identification of conserved regions as broad-spectrum targets

    • Strain-specific inhibitor design for targeted interventions

    • Potential for resistance development through sequence variation

Researchers should conduct thorough sequence alignment analysis of plsY across Salmonella strains to identify conserved domains and variable regions before designing experiments or interpreting results across strains.

How can plsY be leveraged as a potential antimicrobial target?

Glycerol-3-phosphate acyltransferase (plsY) represents a promising antimicrobial target for several reasons:

  • Essential metabolic function:

    • plsY catalyzes a critical step in phospholipid biosynthesis required for bacterial membrane formation

    • Gene knockout studies in related bacteria suggest plsY is essential for viability

  • Target validation approaches:

    • Conditional knockdowns to demonstrate growth inhibition

    • Gene essentiality studies across growth conditions

    • In vivo validation using animal infection models

  • Inhibitor development strategies:

    • High-throughput screening of compound libraries against purified recombinant plsY

    • Structure-based drug design utilizing crystallographic data

    • Fragment-based approaches to identify binding scaffolds

    • Natural product screening for novel inhibitory scaffolds

  • Combination therapy potential:

    • Synergy testing with existing antibiotics

    • Membrane permeabilization to enhance uptake of other antimicrobials

    • Multi-target approaches hitting different steps in phospholipid synthesis

  • Resistance mitigation:

    • Target highly conserved catalytic residues to minimize resistance development

    • Develop dual-targeting inhibitors affecting multiple steps in the same pathway

    • Design peptidomimetics that mimic essential protein-protein interactions

What methodologies are most effective for analyzing plsY interactions with other proteins in the phospholipid synthesis pathway?

To effectively study plsY interactions with other components of the phospholipid synthesis pathway:

  • In vitro interaction analyses:

    • Pull-down assays using purified recombinant plsY with His-tag

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Crosslinking coupled with mass spectrometry for interaction mapping

  • Structural biology approaches:

    • X-ray crystallography of plsY in complex with interaction partners

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for mapping interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify binding regions

  • Cellular interaction studies:

    • Bacterial two-hybrid systems

    • Fluorescence resonance energy transfer (FRET)

    • Split-GFP complementation assays

    • Co-immunoprecipitation from bacterial lysates

    • Proximity labeling methods (BioID, APEX)

  • Systems biology approaches:

    • Protein correlation profiling

    • Genetic interaction mapping through synthetic lethality screens

    • Metabolic flux analysis to assess functional interactions

  • Computational methods:

    • Molecular docking simulations

    • Protein-protein interaction prediction algorithms

    • Metabolic network modeling

    • Evolutionary coupling analysis

How can researchers effectively compare plsY function between pathogenic and non-pathogenic Salmonella strains?

To systematically compare plsY function across pathogenic and non-pathogenic Salmonella strains:

  • Comparative genomics approach:

    • Sequence alignment and phylogenetic analysis of plsY across strains

    • Identification of single nucleotide polymorphisms and their predicted functional impact

    • Analysis of genomic context and operon structure

    • Assessment of selection pressure through dN/dS ratios

  • Biochemical characterization:

    • Side-by-side enzymatic assays of purified recombinant plsY from different strains

    • Determination of enzyme kinetics (Km, Vmax, catalytic efficiency)

    • Substrate specificity profiling

    • Inhibitor sensitivity comparison

    • Thermal and pH stability analyses

  • Functional complementation studies:

    • Cross-complementation of plsY knockouts between strains

    • Phenotypic rescue assessment under various stress conditions

    • Construction of chimeric plsY variants to map functional domains

  • Membrane biology comparisons:

    • Lipidomic analysis of membrane composition

    • Membrane fluidity measurements

    • Antibiotic permeability assays

    • Stress resistance profiling (osmotic, pH, temperature)

  • Host-pathogen interaction experiments:

    • Virulence assessment in infection models

    • Survival within macrophages

    • Inflammatory response elicitation

    • Immune evasion capabilities

These approaches build upon established methodologies in bacterial genetics and protein biochemistry, such as those used to study other bacterial proteins expressed in Salmonella dublin systems .

What statistical approaches are most appropriate for analyzing plsY enzymatic activity data?

When analyzing plsY enzymatic activity data, researchers should consider these statistical approaches:

Data TypeRecommended Statistical Methods
Enzyme kinetics (Michaelis-Menten)- Non-linear regression for Km and Vmax determination
- Lineweaver-Burk or Eadie-Hofstee plots for visual analysis
- Bootstrap resampling for confidence intervals
Inhibition studies- IC50 determination with four-parameter logistic regression
- Global fitting for competitive vs. non-competitive models
- Cheng-Prusoff equation for Ki calculation
Activity comparisons between conditions- ANOVA with appropriate post-hoc tests for multiple comparisons
- t-tests with correction for multiple hypothesis testing
- Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data
Time-course experiments- Area under curve analysis
- Mixed-effects models for repeated measures
- Non-linear regression to mechanistic models
High-throughput screening- Z-factor calculation for assay quality assessment
- Robust Z-score for hit identification
- False discovery rate control for large datasets

For all analyses, researchers should:

  • Perform power analysis to determine appropriate sample sizes

  • Include proper biological and technical replicates

  • Validate statistical assumptions (normality, homoscedasticity)

  • Report effect sizes alongside p-values

  • Consider Bayesian approaches for small sample sizes

How can researchers effectively integrate plsY structural data with functional analyses?

Integrating structural and functional data for plsY requires a multidisciplinary approach:

  • Structure-guided mutagenesis:

    • Identify conserved or functionally important residues through structural analysis

    • Generate site-directed mutants of key residues

    • Perform functional assays on mutants to correlate structure with activity

    • Create a comprehensive structure-function map

  • Molecular dynamics simulations:

    • Simulate plsY behavior in membrane environments

    • Analyze substrate binding and product release pathways

    • Identify conformational changes during catalytic cycle

    • Predict effects of mutations or ligand binding

  • Integrative visualization:

    • Map enzymatic activity data onto structural models

    • Visualize evolutionary conservation in structural context

    • Highlight protein-protein interaction interfaces

    • Correlate thermal stability data with structural features

  • Structure-based inhibitor design:

    • Utilize active site geometry for rational inhibitor design

    • Perform virtual screening against structural pockets

    • Validate binding modes through crystallography or NMR

    • Iteratively improve inhibitors based on structural feedback

  • Comprehensive databases:

    • Develop relational databases linking sequence, structure, and functional data

    • Create visual interfaces for data exploration

    • Implement machine learning to predict function from structure

    • Enable collaborative annotation and analysis

This integration provides a more complete understanding of how plsY's three-dimensional structure enables its role in phospholipid biosynthesis and potentially informs therapeutic targeting strategies.

What are the key considerations when designing experiments to assess plsY's role in antibiotic resistance?

When investigating plsY's potential role in antibiotic resistance, researchers should consider:

  • Experimental design framework:

    • Compare plsY expression levels between resistant and susceptible strains

    • Generate plsY overexpression and knockdown models to assess impact on resistance

    • Perform complementation studies in resistant mutants

    • Conduct time-kill kinetics under various antibiotic pressures

  • Membrane-specific considerations:

    • Analyze changes in membrane phospholipid composition

    • Assess membrane permeability using fluorescent dyes

    • Measure changes in membrane potential

    • Quantify antibiotic accumulation within cells

  • Resistance mechanism investigation:

    • Determine if plsY alterations modify drug target accessibility

    • Assess impact on efflux pump efficiency

    • Investigate potential metabolic adaptations affecting resistance

    • Examine changes in cell wall integrity

  • Clinical relevance assessment:

    • Analyze plsY sequences in clinical isolates with varying resistance profiles

    • Correlate plsY polymorphisms with minimum inhibitory concentrations

    • Test efficacy of combination therapies targeting plsY and established mechanisms

    • Evaluate fitness costs of resistance-associated plsY mutations

  • Controls and validation:

    • Include appropriate susceptible and resistant reference strains

    • Verify that observed effects are specific to plsY (not polar effects)

    • Test multiple antibiotics representing different classes

    • Confirm findings across multiple Salmonella strains

These approaches build upon established methodologies used to study other bacterial components involved in antibiotic resistance and membrane biosynthesis pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.