Recombinant Salmonella dublin Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mscL; SeD_A3777; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function

This channel opens in response to membrane lipid bilayer stretch forces and may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying mscL in Salmonella Dublin compared to other Salmonella serotypes?

Salmonella Dublin is a host-adapted serotype primarily affecting cattle but capable of causing severe systemic disease in humans. Unlike many other serotypes, S. Dublin has demonstrated increasing multidrug resistance patterns in the United States and globally, with 98% of isolates resistant to more than four antimicrobials in recent studies . Mechanosensitive channels like mscL play crucial roles in bacterial adaptation to osmotic challenges during host invasion and environmental persistence.

Research methodological approach: When studying mscL in S. Dublin, researchers should employ comparative genomics between multiple S. Dublin isolates and other Salmonella serotypes. This comparison allows identification of serotype-specific adaptations in mscL sequence, expression, and function. Techniques should include:

  • PCR amplification and sequencing of the mscL gene from diverse S. Dublin isolates

  • Phylogenetic analysis comparing mscL sequences across Salmonella serotypes

  • Expression studies under various osmotic conditions relevant to host environments

How do experimental design considerations differ when working with recombinant S. Dublin mscL versus wild-type strains?

When working with recombinant versus wild-type S. Dublin strains, proper experimental design is critical. Experimental units must be carefully defined, treatments properly randomized, and appropriate controls included to ensure valid statistical inferences .

Methodological approach:

  • Construct deletion mutants of mscL using Lambda Red recombination methods similar to those used for T6SS studies in S. Dublin

  • Create complementation constructs with an inducible promoter to control expression levels

  • When designing experiments, use a complete block design with randomization to minimize bias

  • Include the following controls:

    • Wild-type S. Dublin strain

    • mscL deletion mutant

    • Complemented strain expressing wild-type mscL

    • Vector-only control

Table 1: Example of Experimental Design for mscL Studies in S. Dublin

Experimental GroupGenotypeReplicatesControls
Wild-typeS. Dublin CT_020218536Untreated
ΔmscL mutantS. Dublin CT_02021853 ΔmscL::Kan6Untreated
ComplementedS. Dublin ΔmscL + pVector-mscL6Vector only
ControlS. Dublin ΔphoN6Marker control

What molecular techniques are recommended for verifying successful recombinant expression of mscL in S. Dublin?

Methodological approach:

  • PCR verification: Design primers flanking the mscL gene and insertion site

  • Western blot analysis: Using anti-mscL antibodies or epitope tags (His, FLAG) if incorporated

  • RT-qPCR to quantify mscL transcription levels

  • Functional assays measuring osmotic shock survival

For recombinant expression, researchers should follow protocols similar to those used for T6SS mutagenesis in S. Dublin, which includes:

  • Designing oligonucleotides with 40 bases identical to deletion endpoints

  • Using plasmids containing resistance cassettes flanked by FRT sites

  • Transformation of electrocompetent S. Dublin containing Lambda Red recombination system

  • Selection on appropriate antibiotics

  • Confirmation by PCR amplification

  • Transfer to wild-type background by P22 phage transduction

How does antimicrobial resistance correlate with mscL function in S. Dublin and what methods can detect this relationship?

S. Dublin has become one of the most multidrug-resistant Salmonella serotypes in the United States, with 98% of isolates resistant to more than 4 antimicrobials . While the direct relationship between mscL and antimicrobial resistance isn't established in the literature, mechanosensitive channels might influence drug uptake and efflux.

Methodological approach:

  • Generate mscL mutants in S. Dublin isolates with varying antimicrobial resistance profiles

  • Determine MICs (minimum inhibitory concentrations) for various antibiotics in wild-type vs. mscL mutants

  • Measure antibiotic accumulation using fluorescent-labeled antimicrobials

  • Perform transcriptomics to identify changes in expression of resistance genes in mscL mutants

Table 2: Common AMR Genes in S. Dublin and Techniques to Study Their Relationship with mscL

AMR GenePrevalence in S. DublinResistance ConferredStudy Method with mscL
sulf298.6%SulfonamidesMIC determination in ΔmscL strains
tetA98.6%TetracyclinesTetracycline accumulation assays
aph(6)-Id97.9%AminoglycosidesGentamicin protection assays
floR94.3%PhenicolsChloramphenicol uptake studies
blaCMY-285.7%Beta-lactamsβ-lactamase activity assays

What colonization models are most appropriate for studying the role of recombinant S. Dublin mscL in host adaptation?

S. Dublin is primarily adapted to cattle but can colonize other hosts including humans, mice, and chickens. Research has shown different colonization patterns in murine and avian models .

Methodological approach:

  • Competitive infection assays: Similar to T6SS studies, compare wild-type and ΔmscL mutants in multiple host models

  • Calculate competitive index (CI) using formula: CI = (mutant/wild-type)output/(mutant/wild-type)input

  • Use tissue culture models for initial screening:

    • Bovine mammary epithelial cells (primary relevance)

    • Human intestinal epithelial cells (Caco-2)

    • Murine macrophages (RAW264.7)

  • In vivo models should include:

    • Bovine models (primary host)

    • Murine models (BALB/c mice show identifiable colonization differences)

    • Avian models (chickens can be asymptomatically colonized)

Table 3: Competitive Index Values for S. Dublin T6SS Mutants (Reference Model for mscL Studies)

Host ModelTissueΔT6SS SPI-6 CI (log)ΔT6SS SPI-19 CI (log)ΔT6SS SPI-6/ΔT6SS SPI-19 CI (log)
MouseCecum-0.50-0.5
MouseLiver-0.50-0.5
MouseSpleen-0.50-0.5
ChickenCecum-3.720-3.72
ChickenLiver-1.50-1.5
ChickenSpleen-1.50-1.5

When designing mscL studies, a similar approach can determine the channel's contribution to host colonization .

How can researchers assess the impact of osmotic stress on mscL function in S. Dublin, and what controls are necessary?

Methodological approach:

  • Establish growth curves under various osmotic conditions for wild-type and ΔmscL strains

  • Measure survival rates following hypoosmotic shock

  • Use patch-clamp electrophysiology to directly measure channel activity

  • Implement fluorescent dye release assays to assess membrane permeability

Controls must include:

  • Wild-type S. Dublin strain

  • Complemented ΔmscL strain

  • Strains with point mutations in the channel pore region

  • Osmotic conditions mirroring physiological environments encountered during infection

What genomic approaches can characterize mscL variants in emerging virulent and resistant S. Dublin lineages?

Recent research has identified distinct S. Dublin populations circulating in different geographical regions, with emergence of a North American cluster approximately 60 years ago and two distinct lineages in Australia .

Methodological approach:

  • Whole genome sequencing of diverse S. Dublin isolates

  • Comparative genomics focusing on mscL and surrounding genetic elements

  • Phylogenetic analysis to identify lineage-specific adaptations

  • Analysis of selection pressure on mscL using dN/dS ratios

  • Investigation of potential horizontal gene transfer involving mscL

Researchers should note that S. Dublin isolates show relatively low genomic diversity , suggesting that specific adaptations like mscL variants might play important roles in host adaptation and virulence.

What considerations should be made when designing primers for recombinant mscL expression in S. Dublin?

When constructing recombinant S. Dublin strains expressing modified mscL, primer design is critical. Based on successful mutagenesis approaches used in S. Dublin T6SS studies:

Methodological approach:

  • Design oligonucleotides with 40 bases on 5' ends identical to the target genomic regions

  • Include 20 bases on 3' ends that anneal with antibiotic resistance cassettes

  • Ensure primers contain appropriate restriction sites for subsequent cloning

  • Consider codon optimization for S. Dublin if expressing heterologous mscL variants

  • Include epitope tags (His, FLAG) for detection while ensuring they don't disrupt channel function

Example primer design strategy:

  • Forward primer: 5'-[40bp homology to upstream mscL]-[restriction site]-[20bp template binding]-3'

  • Reverse primer: 5'-[40bp homology to downstream mscL]-[restriction site]-[20bp template binding]-3'

How can researchers troubleshoot contradictory results between in vitro and in vivo models of S. Dublin mscL function?

Methodological approach:

  • Verify construct integrity and expression levels in both systems

  • Compare growth conditions between in vitro and in vivo environments:

    • Nutrient availability

    • Osmolarity differences

    • pH variations

    • Host defense factors

  • Implement tissue culture models as intermediate step between in vitro and in vivo studies

  • Consider dual-reporter systems to monitor mscL expression and activity simultaneously

Table 4: Troubleshooting Contradictory mscL Results

ObservationPossible ExplanationVerification Method
Channel function in vitro but not in vivoHost factors inhibit channelEx vivo assays with host fluids
Phenotype in mouse model but not bovineHost-specific adaptationTest in bovine cell culture
Expression detected but no functionPost-translational modificationProteomic analysis
Inconsistent colonization resultsVariability in inoculum or hostStandardize preparation protocols

What statistical approaches are recommended for analyzing competitive index data from mscL mutant studies?

When analyzing competitive infection data similar to T6SS studies in S. Dublin:

Methodological approach:

  • Log-transform competitive index (CI) values to normalize distribution

  • Apply one-sample t-test to determine if log CI differs significantly from 0

  • Use ANOVA for comparing multiple mutants across different tissues/time points

  • Apply post-hoc tests (e.g., Tukey's HSD) for pairwise comparisons

  • Consider mixed-effects models to account for within-animal correlations

Statistical approach specifics:

  • Sample size determination: Power analysis should aim for 80% power to detect differences of 0.5 log CI

  • Appropriate randomization in block design experiments

  • Blinding procedures during sample processing and analysis

How can electrophysiological techniques be optimized for studying recombinant S. Dublin mscL function?

Methodological approach:

  • Spheroplast preparation:

    • Optimize lysozyme concentration and incubation time specific for S. Dublin

    • Use sucrose gradients to isolate intact spheroplasts

  • Patch-clamp recording:

    • Employ cell-attached configuration for native environment

    • Use excised inside-out patches for controlled solution environments

  • Pressure application:

    • Calibrate pressure transducers specifically for each setup

    • Employ stepped pressure protocols to determine activation thresholds

  • Data analysis:

    • Use specialized software (e.g., pCLAMP, QuB) for single-channel analysis

    • Apply Markov modeling to determine channel kinetics

How might recombinant S. Dublin mscL serve as a target for novel antimicrobial strategies?

With 98% of S. Dublin isolates exhibiting multidrug resistance to more than four antimicrobials , novel targets are urgently needed.

Methodological approach for exploring mscL as an antimicrobial target:

  • High-throughput screening for compounds that modulate mscL gating

  • Testing candidate molecules in growth inhibition and bacterial killing assays

  • Assessing synergy between mscL modulators and conventional antibiotics

  • Evaluating resistance development frequency through serial passage experiments

  • Testing efficacy in animal models of S. Dublin infection

What approaches can determine if mscL expression affects S. Dublin's ability to survive in environmental reservoirs?

S. Dublin can asymptomatically colonize chickens and mice, which may act as reservoirs for cattle and human infection .

Methodological approach:

  • Survival studies comparing wild-type and ΔmscL strains in:

    • Soil samples from agricultural settings

    • Water sources with varying osmolarity

    • Fecal slurry under different environmental conditions

  • Competitive experiments between wild-type and ΔmscL in:

    • Direct transfer between hosts

    • Environmental persistence followed by new host colonization

  • Transcriptional analysis of mscL during environmental stress conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.