Recombinant Salmonella dublin Lipoprotein signal peptidase (lspA)

What is Salmonella Dublin and why is it significant in both veterinary and human medicine?

Salmonella Dublin is a cattle-adapted serotype of Salmonella enterica that causes serious infections in both cattle and humans. In cattle, it results in high morbidity and mortality rates in young calves and decreases performance of mature animals, with clinical signs typically including pneumonia, respiratory distress, and hyperthermia . Originally considered primarily a problem of the West Coast, particularly California, evidence indicates that it has been moving across the country and is now an emerging health problem among dairy cattle in the Northeast United States .

In humans, S. Dublin typically causes bloodstream infections rather than solely gastrointestinal illness. These infections are becoming increasingly common and are resistant to multiple antibiotics, including certain first-line drugs often prescribed for invasive Salmonella infections . Between 2005-2013, data showed that 78% of persons with Salmonella Dublin infection were hospitalized and 4.2% died, representing an increase from the 1996-2004 period (68% hospitalized, 2.7% died) .

What is Lipoprotein signal peptidase (lspA) and what role does it play in Salmonella dublin?

Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an enzyme (EC 3.4.23.36) involved in bacterial lipoprotein processing . This enzyme catalyzes the removal of signal peptides from prolipoproteins, which is a crucial step in bacterial membrane biogenesis and protein trafficking. The processed lipoproteins are essential for bacterial cell envelope integrity, virulence, and potentially antibiotic resistance mechanisms.

In Salmonella Dublin, lspA is encoded by the lspA gene (ordered locus name: SeD_A0051) . While the specific contributions of lspA to Salmonella Dublin pathogenesis are not explicitly detailed in the search results, bacterial lipoproteins generally play important roles in bacterial survival, host-pathogen interactions, and virulence.

What are the structural characteristics of recombinant Salmonella dublin lspA?

The recombinant Salmonella dublin lspA protein has the following key structural characteristics:

• Amino Acid Sequence: MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA

• UniProt ID: B5FHE1

• Source Strain: Salmonella dublin (strain CT_02021853)

• Protein Length: Full length or partial protein, depending on the specific product

• Purity: Typically >85% as determined by SDS-PAGE

The protein contains hydrophobic regions consistent with its membrane-associated function, which can be observed in the amino acid sequence with stretches of hydrophobic residues, particularly in the transmembrane regions.

What are the optimal storage and handling conditions for recombinant lspA?

For optimal preservation of recombinant lspA:

• Storage Temperature: Store at -20°C for regular use; for extended storage, conserve at -20°C or -80°C

• Buffer Composition: Typically provided in a Tris-based buffer with 50% glycerol, optimized for protein stability

• Reconstitution: It is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Long-term Storage: Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

• Working Aliquots: Store at 4°C for up to one week

• Stability Considerations: Repeated freezing and thawing is not recommended

The shelf life is generally 6 months for liquid form at -20°C/-80°C and 12 months for lyophilized form at -20°C/-80°C, although this can vary depending on buffer ingredients, storage temperature, and the intrinsic stability of the protein .

How can researchers differentiate between active and inactive forms of recombinant lspA when designing experiments?

Researchers must verify the enzymatic activity of recombinant lspA before using it in experiments. Several methodological approaches can be employed:

• Enzymatic Activity Assays: Design synthetic peptide substrates that mimic the natural prolipoprotein substrates of lspA. The activity can be measured by detecting cleavage products using techniques like HPLC, mass spectrometry, or fluorescence-based assays with labeled substrates.

• Structural Analysis: Circular dichroism spectroscopy can be used to assess the secondary structure content of the protein, which can indicate proper folding.

• Thermal Shift Assays: These can evaluate protein stability under different buffer conditions and in the presence of potential substrates or inhibitors.

• Size Exclusion Chromatography: This technique can help distinguish between properly folded monomeric protein and aggregated forms.

• Functional Complementation: In genetic studies, the ability of the recombinant lspA to complement an lspA-deficient bacterial strain can provide evidence of functionality.

What role does lspA potentially play in the increasing antimicrobial resistance of Salmonella Dublin?

Salmonella Dublin has shown a dramatic increase in antimicrobial resistance over time. Data shows that the percentage of isolates resistant to more than 7 classes of antimicrobial drugs increased from 2.4% during 1996-2004 to 50.8% during 2005-2013 . This multidrug resistance substantially complicates the treatment and control of salmonellosis due to S. Dublin infection .

While the search results don't directly link lspA to antimicrobial resistance, the enzyme's role in processing bacterial lipoproteins suggests potential mechanisms by which it might contribute:

• Membrane Integrity: Lipoproteins processed by lspA may contribute to membrane structure and permeability, potentially affecting drug entry into the cell.

• Efflux Pump Systems: Some lipoproteins are components of efflux pump systems that can expel antibiotics from bacterial cells.

• Stress Response: Lipoproteins may participate in bacterial stress responses that confer resistance to antimicrobials.

• Biofilm Formation: Certain lipoproteins facilitate biofilm formation, which can enhance bacterial survival in the presence of antibiotics.

Research investigating the effects of lspA inhibition on antibiotic susceptibility could potentially identify new strategies for combating multidrug-resistant Salmonella Dublin.

What methodological approaches can be used to investigate the role of lspA in Salmonella Dublin pathogenesis?

Several sophisticated methodological approaches can be employed to elucidate the role of lspA in Salmonella Dublin pathogenesis:

• Gene Knockout Studies: Creating isogenic lspA mutants in Salmonella Dublin and comparing their virulence to wild-type strains in appropriate animal models.

• Conditional Expression Systems: Developing strains with regulatable lspA expression to study the effects of varying lspA levels on bacterial physiology and virulence.

• Protein-Protein Interaction Studies: Using techniques such as pull-down assays, co-immunoprecipitation, or bacterial two-hybrid systems to identify proteins that interact with lspA or its substrates.

• Transcriptomics and Proteomics: Comparing gene expression and protein profiles between wild-type and lspA-deficient strains to identify downstream effects of lspA activity.

• Infection Models: Using both in vitro cell culture systems (particularly bovine cell lines) and in vivo models to assess the impact of lspA modification on:

  • Bacterial adherence and invasion

  • Intracellular survival

  • Immune response modulation

  • Bacterial dissemination

• Structural Biology Approaches: Using X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of lspA, which can inform understanding of its function and potential inhibitor design.

How does Salmonella Dublin lspA compare to lspA from other Salmonella serotypes, and what are the implications for host adaptation?

Comparative analysis of lspA across different Salmonella serotypes could provide insights into the role of this enzyme in host adaptation. Salmonella Dublin is specifically adapted to cattle , while other serotypes may preferentially infect different hosts.

Researchers investigating this question should consider:

• Sequence Analysis: Comparing the amino acid sequences of lspA across Salmonella serotypes to identify conserved regions and serotype-specific variations.

• Substrate Specificity: Determining whether lspA from different serotypes processes different sets of lipoproteins, which might contribute to host tropism.

• Expression Patterns: Analyzing whether lspA expression levels differ among serotypes or change during infection of different host species.

• Structural Differences: Identifying any structural distinctions in lspA that might affect its function in different serotypes.

• Cross-Complementation Studies: Testing whether lspA from one serotype can functionally replace lspA from another serotype, particularly in the context of host infection models.

Understanding these differences could provide insights into the molecular basis of Salmonella host adaptation and potentially inform the development of serotype-specific interventions.

How can recombinant lspA be utilized in developing novel diagnostic tools for Salmonella Dublin infections?

Current diagnosis of Salmonella Dublin is based on bacterial identification via culture or PCR assay, or on serological testing . Recombinant lspA offers several possibilities for improving diagnostic methods:

• Serological Assays: Developing ELISA-based tests using recombinant lspA as an antigen to detect anti-lspA antibodies in infected animals or humans. This could be particularly valuable for:

  • Detecting carrier animals that chronically shed the bacterium

  • Screening bulk milk tanks (as was done in the Cornell study that screened nearly 5,000 New York dairy herds)

  • Epidemiological surveillance

• Molecular Diagnostics: Designing specific primers or probes targeting the lspA gene for use in PCR-based detection methods with improved specificity.

• Rapid Point-of-Care Tests: Developing lateral flow assays or biosensors using antibodies against lspA for field-applicable diagnostics.

• Multiplex Assays: Incorporating lspA detection into multiplex platforms that can simultaneously detect multiple Salmonella serotypes or virulence factors.

Such improved diagnostics could help address the challenge of identifying carrier animals that chronically shed the bacterium, which makes Salmonella Dublin difficult to eradicate from herds .

What is the potential of lspA as a target for novel antimicrobials against multidrug-resistant Salmonella Dublin?

The increasing prevalence of multidrug-resistant Salmonella Dublin strains creates an urgent need for novel antimicrobial strategies. LspA represents a promising target for several reasons:

• Essential Function: As a processor of bacterial lipoproteins, lspA likely plays an essential role in bacterial viability or virulence.

• Absence in Mammals: LspA has no mammalian homolog, potentially allowing for selective targeting with minimal host toxicity.

• Surface Accessibility: As a membrane enzyme, lspA may be more accessible to inhibitors compared to cytoplasmic targets.

• Broad Impact: Inhibiting lspA would affect multiple lipoproteins simultaneously, potentially disrupting various bacterial functions.

Research approaches to develop lspA inhibitors might include:

• High-Throughput Screening: Testing chemical libraries for compounds that inhibit lspA activity.

• Structure-Based Drug Design: Using the three-dimensional structure of lspA (if available) to design targeted inhibitors.

• Peptide-Based Inhibitors: Developing peptide mimetics that compete with natural substrates.

• Combination Therapy: Investigating whether lspA inhibitors could sensitize resistant strains to existing antibiotics.

How might recombinant lspA contribute to vaccine development against Salmonella Dublin?

The search results indicate that the effectiveness of current vaccines against Salmonella Dublin remains unclear , suggesting a need for improved vaccine strategies. Recombinant lspA could contribute to vaccine development in several ways:

• Subunit Vaccines: Using recombinant lspA or specific epitopes as antigens in subunit vaccine formulations.

• Live Attenuated Vaccines: Creating Salmonella Dublin strains with modified lspA expression or function as potential live attenuated vaccines.

• Immune Response Characterization: Studying the immune response to lspA to better understand protective immunity against Salmonella Dublin.

• Adjuvant Development: Investigating whether lspA or lspA-processed lipoproteins have immunomodulatory properties that could enhance vaccine efficacy.

• Reverse Vaccinology: Using computational approaches to identify immunogenic epitopes within lspA that could be incorporated into multi-epitope vaccines.

Vaccination studies would need to address the dual challenges of preventing disease in cattle and reducing the risk of zoonotic transmission to humans .

What are the most effective methods for expressing and purifying functional recombinant Salmonella Dublin lspA?

Based on available information and general principles of membrane protein biochemistry, researchers should consider the following approaches:

• Expression Systems:

  • E. coli appears to be a viable expression host for recombinant lspA

  • Consider specialized E. coli strains designed for membrane protein expression

  • For challenging constructs, alternative systems like yeast or insect cells might be necessary

• Fusion Tags:

  • Tag selection will be determined during the production process

  • Consider solubility-enhancing tags (MBP, SUMO) for improved expression

  • His-tags are useful for purification but may affect function

  • Include a cleavable linker if the tag might interfere with activity

• Extraction and Solubilization:

  • As a membrane protein, lspA will require detergent solubilization

  • Test multiple detergent classes (maltoside, glucoside, fos-choline)

  • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for near-native environment

• Purification Strategy:

  • Multi-step purification typically yields higher purity

  • Combine affinity chromatography with size exclusion and/or ion exchange

  • Target purity should exceed 85% by SDS-PAGE

• Activity Preservation:

  • Include protease inhibitors throughout purification

  • Maintain cold temperatures during processing

  • Consider addition of stabilizing agents such as glycerol

What experimental controls are essential when studying the enzymatic activity of recombinant lspA?

When designing experiments to study lspA activity, researchers should include these essential controls:

• Negative Controls:

  • Heat-inactivated lspA preparation

  • Site-directed mutant with substitutions at catalytic residues

  • Reaction mixtures lacking substrate

  • Reaction mixtures lacking enzyme

• Positive Controls:

  • Commercial peptidases with similar activity, if available

  • Previously characterized batch of active lspA

  • Known substrates with established cleavage patterns

• Specificity Controls:

  • Non-substrate peptides that should not be cleaved

  • Inhibitor specificity panels

  • Competitive substrate assays

• Technical Controls:

  • Standard curves for quantification methods

  • Internal controls for normalization

  • Time-course measurements to ensure linear range of activity

• Validation Approaches:

  • Multiple detection methods for cleavage products

  • Mass spectrometry verification of cleavage sites

  • Correlation between in vitro activity and in vivo function

These controls ensure that experimental results accurately reflect lspA activity rather than artifacts or contaminating activities.

What are the most promising areas for future research on Salmonella Dublin lspA?

Considering the increasing prevalence and antimicrobial resistance of Salmonella Dublin , several high-priority research directions emerge:

• Structural Biology: Determining the three-dimensional structure of Salmonella Dublin lspA would enable structure-based drug design and provide insights into its function.

• Host-Pathogen Interactions: Investigating how lspA-processed lipoproteins interact with host immune cells, particularly in the context of bovine immunity.

• Comparative Studies: Analyzing lspA variation across Salmonella serotypes and its relationship to host adaptation and virulence.

• Inhibitor Development: Screening for and developing specific inhibitors of lspA as potential novel antimicrobials.

• Vaccine Research: Exploring the potential of lspA as a component of vaccines against Salmonella Dublin.

• Resistance Mechanisms: Investigating the relationship between lspA function and antimicrobial resistance.

• Diagnostic Development: Creating improved diagnostic tools based on lspA detection or serological responses to lspA.

These research directions address pressing concerns related to both animal health and public health, as Salmonella Dublin represents both an economic burden to the dairy industry and a zoonotic risk to humans .

Table 1: Temporal changes in human Salmonella Dublin infection characteristics in the United States