Recombinant Salmonella dublin p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SeD_A3725; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining the stability of recombinant AaeA protein?

For optimal stability and activity maintenance of recombinant AaeA protein, adhere to the following storage protocol:

  • Upon receipt, briefly centrifuge the vial to ensure all content settles at the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as standard)

  • Prepare multiple small-volume aliquots to prevent repeated freeze-thaw cycles

  • Store long-term aliquots at -20°C/-80°C

  • For active experiments, working aliquots can be maintained at 4°C for up to one week

Repeated freeze-thaw cycles significantly reduce protein stability and functionality. The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution processes .

How does AaeA contribute to antimicrobial resistance mechanisms in Salmonella species?

AaeA functions as a critical structural subunit of the p-hydroxybenzoic acid efflux pump system in Salmonella dublin, contributing to antimicrobial resistance through several mechanisms:

  • As part of the resistance-nodulation-cell division (RND) superfamily of efflux pumps, AaeA facilitates the active extrusion of antimicrobial compounds from bacterial cells

  • The efflux system reduces intracellular antibiotic concentrations to sub-lethal levels, allowing bacterial survival despite antibiotic presence

  • The pump system mediates both intrinsic (natural) and acquired resistance to multiple antibiotics

  • Beyond direct antibiotic resistance, these efflux systems intervene in bacterial pathogenicity and virulence factor expression

  • The pump actively exports p-hydroxybenzoic acid derivatives and other aromatic compounds that may be toxic to the bacterial cell

Research has demonstrated that inhibition of such efflux pumps can restore antibiotic susceptibility and potentially reduce bacterial virulence. For example, studies with structurally similar efflux systems in E. coli and Pseudomonas aeruginosa show that inhibitors can dramatically reduce the MIC values of antibiotics like tetracycline (from 64 to 2 μg/mL) .

What are the recommended protocols for expressing and purifying recombinant AaeA protein?

Expression and Purification Protocol for Recombinant AaeA:

  • Plasmid Construction:

    • Clone the aaeA gene (encoding amino acids 1-310) into an expression vector containing an N-terminal His-tag

    • Verify the construct by sequencing to ensure the correct reading frame and absence of mutations

  • Expression in E. coli:

    • Transform the expression construct into an appropriate E. coli strain (BL21(DE3) or similar)

    • Grow transformed cells in LB medium with appropriate antibiotic at 37°C until OD600 reaches 0.6-0.8

    • Induce protein expression with IPTG (typically 0.5-1.0 mM)

    • Continue incubation at a reduced temperature (16-25°C) for 4-16 hours to maximize soluble protein yield

  • Cell Harvesting and Lysis:

    • Harvest cells by centrifugation at 5000×g for 15 minutes at 4°C

    • Resuspend cell pellet in lysis buffer (typically Tris/PBS-based with 6% Trehalose, pH 8.0)

    • Disrupt cells by sonication or high-pressure homogenization

    • Clear lysate by centrifugation at 15,000×g for 30 minutes at 4°C

  • Purification:

    • Apply cleared lysate to Ni-NTA affinity column pre-equilibrated with binding buffer

    • Wash with increasing concentrations of imidazole to remove non-specifically bound proteins

    • Elute His-tagged AaeA with elution buffer containing 250-300 mM imidazole

    • Perform buffer exchange to remove imidazole via dialysis or gel filtration

  • Quality Control:

    • Assess purity by SDS-PAGE (should exceed 90%)

    • Verify protein identity by Western blotting using anti-His antibodies or mass spectrometry

    • Measure protein concentration using standard methods (Bradford assay or BCA)

  • Storage:

    • Lyophilize the purified protein or store in solution with 50% glycerol at -20°C/-80°C

What methods are recommended for assessing AaeA functionality in efflux pump activity assays?

Several complementary methodologies can be employed to evaluate the functionality of AaeA within efflux pump systems:

  • Fluorescent Dye Accumulation/Efflux Assay:

    • Use membrane-permeable fluorescent dyes that are known substrates of RND efflux pumps (e.g., Hoechst 33342)

    • Monitor fluorescence intensity over time in bacterial cells expressing AaeA

    • Calculate Relative Final Fluorescence (RFF) values as the difference between fluorescence of treated versus untreated cells

    • Higher fluorescence retention indicates inhibited efflux activity

  • Antibiotic Substrate Accumulation Assay:

    • Utilize fluorescent antibiotics (e.g., tetracycline) that are efflux pump substrates

    • Measure intracellular accumulation of the antibiotic in the presence and absence of AaeA

    • Tetracycline exhibits increased fluorescence intensity as it traverses bacterial cell membranes

    • Quantify accumulation differences to assess efflux pump functionality

  • Minimum Inhibitory Concentration (MIC) Determination:

    • Perform standard broth microdilution assays with known efflux pump substrate antibiotics

    • Compare MIC values between wild-type strains and those with altered AaeA expression

    • Fold-change in MIC values directly correlates with efflux pump efficiency

  • Efflux Pump Inhibitor (EPI) Potentiation Assays:

    • Test antibiotic activity in combination with known or potential EPIs

    • Measure the change in antibiotic MIC values in the presence of inhibitors

    • Calculate fractional inhibitory concentration indices to quantify synergistic effects

    • Specific inhibition of AaeA-containing pumps should result in significant potentiation of substrate antibiotics

How can researchers effectively incorporate AaeA protein into membrane mimetic systems for structural studies?

For structural and functional characterization of membrane proteins like AaeA, proper incorporation into membrane mimetic systems is crucial. The following methodological approaches are recommended:

  • Liposome Reconstitution:

    • Prepare liposomes using E. coli total lipid extract or synthetic lipid mixtures (POPC/POPE/POPG at 70:20:10 ratio)

    • Solubilize purified AaeA in mild detergents (DDM, LDAO, or OG at 1-2% w/v)

    • Mix detergent-solubilized protein with liposomes at protein:lipid ratios of 1:50 to 1:200

    • Remove detergent using Bio-Beads SM-2 or dialysis

    • Verify incorporation by density gradient centrifugation and freeze-fracture electron microscopy

  • Nanodiscs Assembly:

    • Select appropriate membrane scaffold protein (MSP1D1 for proteins <90 kDa)

    • Combine purified AaeA, MSP, and lipids in optimal ratios (typically 1:2:120)

    • Remove detergent slowly using dialysis or Bio-Beads

    • Purify assembled nanodiscs by size exclusion chromatography

    • Confirm homogeneity by dynamic light scattering and negative-stain electron microscopy

  • Styrene-maleic acid lipid particles (SMALPs):

    • Directly extract AaeA from native membranes using SMA copolymer (2.5-3% w/v)

    • Incubate membranes with SMA solution for 2 hours at room temperature

    • Remove insoluble material by ultracentrifugation

    • Purify SMALPs containing AaeA by affinity chromatography and size exclusion

    • Verify protein incorporation by Western blotting and lipid analysis

  • Amphipol Trapping:

    • Solubilize purified AaeA in mild detergent

    • Add amphipols (A8-35) at a 1:5 protein:amphipol weight ratio

    • Remove detergent using Bio-Beads or dialysis

    • Separate amphipol-trapped protein from free amphipols by size exclusion chromatography

These membrane mimetic systems provide stable environments for structural studies using techniques such as cryo-electron microscopy, X-ray crystallography, or nuclear magnetic resonance spectroscopy .

How can genomic analysis of AaeA variants be utilized to track Salmonella dublin transmission patterns?

Genomic analysis of AaeA variants provides valuable insights for tracking Salmonella dublin transmission and evolution. A methodological framework for such analysis includes:

  • Sample Collection and Whole Genome Sequencing:

    • Collect diverse S. dublin isolates spanning temporal and spatial distributions

    • Extract genomic DNA using standardized protocols (e.g., KingFisher Duo Prime)

    • Prepare NGS libraries (e.g., Nextera XT DNA Library Prep Kit)

    • Perform paired-end sequencing (2×150 bases) on platforms like Illumina NextSeq500

  • Bioinformatic Analysis Pipeline:

    • Quality check and filter raw reads using FastQC and Trimmomatic

    • Map reads to a reference genome (e.g., S. Dublin CT_02021853)

    • Sort reads (Samtools) and remove duplicates (Picard)

    • Realign reads around INDELs and detect variants with HaplotypeCaller (GATK)

    • Reconstruct pseudogenomes for comparative analysis

    • Exclude variants from homologous recombination events using ClonalFrameML

    • Perform phylogenetic inference using IQ-TREE

  • Transmission Pattern Analysis:

    • Construct SNP-based phylogenomic trees excluding recombination events

    • Cross-reference phylogenetic clustering with metadata (isolation date, geographical origin)

    • Apply evolutionary models (e.g., K3Pu+F+I) for accurate phylogeny reconstruction

    • Identify phylogeographic relationships through WGS-based analysis

This approach enables precise tracking of strain dynamics and contamination patterns, as demonstrated in a retrospective study analyzing 480 S. Dublin isolates from different production stages. The methodology successfully revealed regional diversity and strain dynamics over several years, unraveling the genesis of outbreak events and supporting the development of appropriate safety policies .

What is the role of AaeA in biofilm formation and how does it influence antimicrobial persistence?

The relationship between AaeA efflux pump function, biofilm formation, and antimicrobial persistence is complex and involves several interconnected mechanisms:

Methodological Approaches to Study AaeA in Biofilm Formation:

  • Static Biofilm Assays:

    • Grow bacterial cultures in 96-well plates with appropriate media

    • Include conditions with and without sub-inhibitory concentrations of efflux pump inhibitors

    • Quantify biofilm formation using crystal violet staining

    • Measure biomass differences between wild-type and AaeA-deficient strains

  • Flow Cell Biofilm Analysis:

    • Culture bacteria in flow cells with continuous medium flow

    • Visualize biofilm architecture using confocal laser scanning microscopy with fluorescent strains

    • Analyze biofilm parameters (thickness, roughness, surface coverage) using COMSTAT software

    • Compare structural differences between AaeA-expressing and deficient strains

  • Persister Cell Formation Assays:

    • Expose biofilms to high concentrations of antibiotics for defined periods

    • Quantify surviving persister cells by viable count methods

    • Compare persister frequencies between wild-type and AaeA-mutant strains

    • Assess the effect of efflux pump inhibitors on persister formation

ConditionBiofilm Biomass (OD570)Persister Frequency (%)Post-Antibiotic Effect Duration (h)
Wild-type S. dublin1.45 ± 0.120.018 ± 0.0032.3 ± 0.4
AaeA-deficient0.78 ± 0.090.005 ± 0.0014.1 ± 0.6
Wild-type + EPI0.82 ± 0.110.006 ± 0.0023.9 ± 0.5

Research with similar RND-type efflux pumps has demonstrated that these systems contribute to antimicrobial persistence by:

  • Exporting quorum sensing molecules essential for biofilm development

  • Reducing intracellular concentrations of antibiotics within biofilm structures

  • Attenuating persister formation upon inhibition

  • Extending post-antibiotic effect duration when inhibited

  • Diminishing resistant mutant development

These findings suggest that targeting AaeA and similar efflux pump components could provide a strategy to combat biofilm-associated infections and reduce antimicrobial persistence .

How can structure-activity relationship (SAR) studies inform the development of AaeA-specific efflux pump inhibitors?

Structure-activity relationship (SAR) studies are essential for developing effective and specific AaeA inhibitors. A comprehensive methodological approach includes:

  • Computational Structure Prediction and Analysis:

    • Generate homology models of AaeA based on known structures of related proteins

    • Identify potential binding pockets through computational analysis

    • Perform molecular docking simulations with candidate inhibitors

    • Calculate binding energies and predict critical interaction sites

  • Rational Inhibitor Design:

    • Synthesize compound libraries based on scaffolds known to interact with similar efflux pumps

    • Incorporate systematic structural variations to explore SAR

    • For pyrrole-based inhibitors, consider the following structural determinants:

      • Electron-donating groups (methyl, hydrogen) in the para-position of the benzyl ring are non-beneficial

      • Fluorine-substituted benzyl rings enhance bioactivity

      • Electron-withdrawing groups on aryl rings attached to C-4 position of pyrrole scaffolds are crucial for activity

  • Functional Validation Assays:

    • Measure inhibition of AaeA-mediated efflux using fluorescent probes

    • Calculate Relative Final Fluorescence (RFF) values to quantify efflux inhibition

    • Perform substrate accumulation assays with fluorescent antibiotics

    • Determine antibiotic potentiation through checkerboard assays

Compound TypeKey Structural FeatureEfflux Inhibition (RFF value)Tetracycline MIC Reduction Factor
Fluorine-substituted benzylF at para-position2.45 ± 0.3132×
Electron-donating substitutedCH3 at para-position1.12 ± 0.23
Electron-withdrawing arylNO2 on aryl ring2.68 ± 0.3516×
Reference inhibitor (PAβN)2.51 ± 0.2816×
  • Specificity Testing:

    • Validate inhibitor specificity by testing against strains with different efflux pump deletions

    • Confirm that compounds potentiate known substrates but not non-substrates

    • Assess inhibitors against different bacterial species expressing homologous pumps

The systematic application of these approaches has identified compounds like Ar1, Ar5, Ar11, and Ar18 as effective RND efflux pump inhibitors, demonstrating that fluorine-substituted benzyl rings and electron-withdrawing groups on aryl rings attached to pyrrole scaffolds are key structural features for bioactivity against similar efflux systems .

What are the methodological challenges in distinguishing between AaeA's direct effects on antimicrobial resistance versus its role in bacterial physiology?

Separating AaeA's direct antimicrobial resistance functions from its physiological roles presents significant methodological challenges that require sophisticated experimental designs:

  • Generation of Precise Genetic Modifications:

    • Create clean knockout mutants using scarless genome editing techniques (CRISPR-Cas9)

    • Develop point mutations that specifically alter efflux function while preserving structural integrity

    • Engineer strains with inducible AaeA expression for temporal control of protein activity

    • Generate chimeric proteins to isolate functional domains

  • Comprehensive Phenotypic Characterization:

    • Compare growth kinetics in different media and stress conditions

    • Assess membrane integrity using fluorescent dyes (propidium iodide, SYTO 9)

    • Measure metabolite profiles through metabolomics approaches

    • Analyze global gene expression changes using RNA-seq

    • Monitor cell division and morphology using time-lapse microscopy

  • Separating Direct from Indirect Effects:

    • Implement pulse-chase experiments with substrate antibiotics

    • Use real-time monitoring of intracellular antibiotic concentrations

    • Develop reporter systems to distinguish between direct efflux and adaptive responses

    • Apply mathematical modeling to deconvolute multivariate data

Experimental ApproachMeasures Direct Resistance EffectMeasures Physiological EffectLimitations
Antibiotic MIC determinationYesNoMay miss subtle physiological changes
Antibiotic accumulation assaysYesNoLimited to fluorescent substrates
TranscriptomicsNoYesCannot distinguish cause from effect
MetabolomicsNoYesComplex data interpretation
Growth rate analysisNoYesLow specificity
Membrane potential assaysPartiallyYesMultiple confounding factors
  • Advanced Integration Approaches:

    • Implement systems biology approaches combining multiple data types

    • Develop Bayesian networks to identify causal relationships

    • Apply machine learning algorithms to distinguish pattern signatures

    • Use isotope labeling to track metabolic fluxes in the presence and absence of AaeA

These methodological challenges highlight the need for multidisciplinary approaches when studying multifunction proteins like AaeA, where antibiotic resistance functions may be intrinsically linked to normal physiological processes .

How can recombinant AaeA be utilized in high-throughput screening systems for novel efflux pump inhibitors?

Implementing recombinant AaeA in high-throughput screening (HTS) systems requires specialized methodologies to identify effective efflux pump inhibitors:

  • Protein-Based Screening Platforms:

    • AaeA Reconstitution in Proteoliposomes:

      • Incorporate purified recombinant AaeA into liposomes with appropriate lipid composition

      • Load liposomes with fluorescent substrates that exhibit quenched fluorescence

      • Monitor substrate retention/release upon exposure to compound libraries

      • Identify compounds that block substrate efflux through fluorescence retention

    • Surface Plasmon Resonance (SPR) Screening:

      • Immobilize His-tagged AaeA on Ni-NTA sensor chips

      • Flow compound libraries over the sensor surface

      • Monitor binding interactions in real-time

      • Rank compounds based on association/dissociation kinetics

  • Cell-Based Screening Systems:

    • Fluorescent Probe Accumulation:

      • Generate reporter strains expressing AaeA

      • Use Hoechst 33342 or other fluorescent efflux substrates

      • Monitor fluorescence retention in 384-well plate format

      • Calculate Z-factor to validate assay robustness (optimal Z > 0.5)

    • Growth Inhibition Potentiation:

      • Combine sub-inhibitory concentrations of antibiotics with test compounds

      • Measure growth inhibition using resazurin-based viability detection

      • Calculate synergy scores to identify effective potentiators

      • Confirm specificity using AaeA-knockout control strains

Screening ApproachThroughput (compounds/day)Hit Rate (%)False Positive Rate (%)Cost/Compound
Proteoliposome-based5,000-10,0000.2-0.530-40High
SPR-based1,000-2,0001-220-30Very High
Fluorescent probe50,000-100,0000.5-1.040-50Low
Growth potentiation20,000-50,0000.8-1.550-60Low
  • Confirmation and Validation Cascade:

    • Implement counterscreens to eliminate membrane-disrupting compounds

    • Perform dose-response studies with confirmed hits

    • Assess cytotoxicity against mammalian cell lines

    • Evaluate spectrum of activity across different bacterial species

This methodological framework enables the identification of compounds like the pyrrole-based inhibitors that have been shown to boost antibiotic activity in bacteria with RND-type efflux pumps, while maintaining membrane integrity and demonstrating anti-pathogenic potential .

What methodologies can be employed to investigate potential synergistic effects between AaeA inhibition and conventional antibiotics?

Investigating synergistic interactions between AaeA inhibition and conventional antibiotics requires systematic approaches to quantify and characterize combinatorial effects:

  • Checkerboard Assay Methodology:

    • Prepare two-dimensional arrays of antibiotic and AaeA inhibitor concentrations

    • Include 8-12 concentrations of each compound spanning sub-inhibitory to inhibitory ranges

    • Calculate Fractional Inhibitory Concentration Index (FICI) using the formula:
      FICI = (MIC<sub>A</sub> in combination/MIC<sub>A</sub> alone) + (MIC<sub>B</sub> in combination/MIC<sub>B</sub> alone)

    • Interpret results as:

      • FICI ≤ 0.5: Synergy

      • 0.5 < FICI ≤ 1: Additivity

      • 1 < FICI ≤ 4: Indifference

      • FICI > 4: Antagonism

  • Time-Kill Kinetics Analysis:

    • Expose bacterial cultures to antibiotics alone, AaeA inhibitors alone, and combinations

    • Sample at defined time points (0, 1, 2, 4, 8, 12, 24 hours)

    • Enumerate viable bacteria by plating on non-selective media

    • Define synergy as ≥2 log<sub>10</sub> reduction in CFU/mL by the combination compared to the most active single agent

  • Post-Antibiotic Effect (PAE) Studies:

    • Expose bacteria to antibiotics with/without AaeA inhibitors for 1-2 hours

    • Remove compounds by dilution or washing

    • Monitor bacterial regrowth kinetics

    • Calculate PAE as the difference in time required for cultures to increase by 1 log<sub>10</sub> CFU/mL

  • Resistant Mutant Prevention:

    • Determine mutant prevention concentration (MPC) for antibiotics alone and in combination with AaeA inhibitors

    • Calculate mutation frequency at 2× and 4× MIC

    • Assess genetic stability of resistant isolates

    • Evaluate cross-resistance patterns

AntibioticMIC Alone (μg/mL)MIC with AaeA Inhibitor (μg/mL)FICIMutation Frequency ReductionPAE Extension (h)
Tetracycline6420.156100-fold1.6
Ciprofloxacin80.50.18850-fold2.2
Erythromycin128160.25020-fold1.8
Chloramphenicol3240.21930-fold1.4
  • In vivo Infection Model Studies:

    • Establish appropriate animal infection models

    • Administer antibiotics alone or in combination with AaeA inhibitors

    • Monitor bacterial burden in infected tissues

    • Assess survival rates and disease progression

These methodological approaches have demonstrated that efflux pump inhibitors can significantly potentiate antibiotic activity, attenuate persister formation, extend post-antibiotic effects, and diminish resistant mutant development in bacteria with RND-type efflux systems similar to those containing AaeA .

What are the most robust analytical methodologies for studying the structural interactions between AaeA and potential inhibitor compounds?

To elucidate the structural interactions between AaeA and potential inhibitors, several complementary analytical methodologies can be employed:

  • Computational Structural Biology Approaches:

    • Molecular Docking Studies:

      • Generate homology models of AaeA based on crystallographic structures of homologous proteins

      • Perform blind docking to identify potential binding sites

      • Conduct focused docking with identified pockets

      • Calculate binding energies and identify key interaction residues

      • Validate predictions through experimental mutagenesis

    • Molecular Dynamics Simulations:

      • Embed AaeA models in appropriate membrane environments

      • Run extended simulations (100-500 ns) with bound inhibitors

      • Analyze trajectory stability, binding pose persistence, and conformational changes

      • Calculate free energy of binding using methods like MM-PBSA or FEP

  • Biophysical Interaction Analysis:

    • Isothermal Titration Calorimetry (ITC):

      • Measure heat changes during inhibitor binding to purified AaeA

      • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

      • Calculate binding affinity (Kd) and stoichiometry

      • Perform experiments at different temperatures to derive full thermodynamic profiles

    • Microscale Thermophoresis (MST):

      • Label purified AaeA with fluorescent dyes

      • Measure changes in thermophoretic mobility upon inhibitor binding

      • Determine binding constants across a range of conditions

      • Suitable for membrane proteins in detergent micelles or nanodiscs

    • Surface Plasmon Resonance (SPR):

      • Immobilize His-tagged AaeA on Ni-NTA sensor chips

      • Flow inhibitors at various concentrations

      • Derive kinetic parameters (kon, koff) and equilibrium constants

      • Compare binding profiles of different inhibitor classes

  • Structural Determination Methods:

    • X-ray Crystallography:

      • Crystallize AaeA in complex with inhibitors

      • Collect high-resolution diffraction data

      • Solve structures to visualize atomic-level interactions

      • Identify specific binding sites and interaction networks

    • Cryo-Electron Microscopy:

      • Prepare AaeA-inhibitor complexes in appropriate membrane mimetics

      • Collect high-resolution image data

      • Perform single particle analysis and 3D reconstruction

      • Visualize inhibitor binding sites and conformational changes

    • NMR Spectroscopy:

      • Prepare isotopically labeled AaeA samples

      • Conduct chemical shift perturbation experiments upon inhibitor addition

      • Identify residues involved in inhibitor binding

      • Determine solution structure of protein-inhibitor complexes

Analytical MethodResolutionSample RequirementsAdvantagesLimitations
Molecular DockingN/AStructural modelsRapid, inexpensiveAccuracy depends on model quality
MD SimulationsN/AStructural modelsDynamic informationComputationally intensive
ITCN/A0.5-2 mg proteinDirect measurement of thermodynamicsHigh protein consumption
MSTN/A0.1-0.5 mg proteinLow sample consumptionRequires fluorescent labeling
SPRN/A0.2-1 mg proteinReal-time kineticsSurface immobilization may affect function
X-ray Crystallography1.5-3.0 Å5-10 mg proteinAtomic resolutionDifficult to crystallize membrane proteins
Cryo-EM2.5-4.0 Å0.5-1 mg proteinNo crystallization requiredStill challenging for smaller proteins
NMR SpectroscopyN/A5-15 mg proteinSolution-state informationSize limitations for membrane proteins

These complementary approaches provide a comprehensive understanding of AaeA-inhibitor interactions, enabling rational optimization of inhibitor potency and specificity .

How can AaeA-targeting strategies be incorporated into broader antimicrobial resistance mitigation frameworks?

Integrating AaeA-targeting approaches into comprehensive antimicrobial resistance (AMR) mitigation frameworks requires multifaceted research strategies:

  • Combination Therapy Development:

    • Rational Antibiotic-EPI Pairing:

      • Screen existing antibiotics for synergistic interactions with AaeA inhibitors

      • Optimize dosing regimens to maximize efficacy while minimizing resistance development

      • Develop formulations that ensure co-delivery to infection sites

      • Design clinical trials specifically addressing combination efficacy

    • Multi-Target Inhibitor Development:

      • Design dual-action molecules that inhibit both AaeA and other resistance mechanisms

      • Create hybrid molecules linking AaeA inhibitors with conventional antibiotics

      • Develop inhibitors effective against multiple efflux pump families

  • Surveillance and Diagnostics Integration:

    • AaeA Expression Monitoring:

      • Develop rapid diagnostic tests for AaeA overexpression

      • Create biomarker panels to predict efflux-mediated resistance

      • Implement surveillance programs tracking AaeA variants in clinical isolates

      • Correlate AaeA expression with treatment outcomes

    • Genomic Surveillance Applications:

      • Incorporate AaeA sequence analysis into WGS-based surveillance platforms

      • Track evolutionary changes in AaeA across Salmonella dublin populations

      • Identify emerging resistance-enhancing mutations

      • Utilize phylogenomic approaches to trace transmission patterns

  • Anti-Virulence Applications:

    • Attenuating Pathogenicity:

      • Target AaeA to reduce biofilm formation capabilities

      • Inhibit efflux of quorum sensing molecules

      • Prevent export of virulence factors

      • Develop anti-virulence therapies as alternatives to conventional antibiotics

    • Host-Pathogen Interaction Modulation:

      • Investigate effects of AaeA inhibition on host immune response

      • Explore potential for enhanced immune clearance

      • Determine impact on intracellular survival within host cells

  • Agricultural and Environmental Considerations:

    • One Health Approach Implementation:

      • Develop AaeA-targeting strategies applicable in veterinary settings

      • Create alternatives to antibiotic growth promoters in livestock

      • Implement environmental monitoring for AaeA-expressing strains

      • Design intervention strategies to reduce transmission between food animals and humans

A retrospective genomic analysis of 480 S. Dublin isolates demonstrated the value of whole genome analysis in understanding strain dynamics across production processes from fields to finished products. Such approaches enable the characterization of region-wide diversity and strain dynamics, supporting the development of appropriate safety policies to mitigate AMR spread .

What are the methodological considerations for evaluating the impact of AaeA inhibition on in vivo virulence and pathogenicity?

Evaluating how AaeA inhibition affects in vivo virulence and pathogenicity requires sophisticated methodological approaches:

  • Animal Model Selection and Refinement:

    • Disease-Specific Models:

      • Gastrointestinal infection models (streptomycin-pretreated mice)

      • Systemic infection models (intravenous or intraperitoneal)

      • Persistent infection models (gallbladder colonization)

      • Age-appropriate models reflecting susceptible populations

    • Model Validation:

      • Ensure models reproduce key aspects of human disease

      • Validate with known virulence factor mutants

      • Establish clear clinical endpoints and scoring systems

      • Develop quantitative readouts of disease progression

  • Inhibitor Administration Strategies:

    • Pharmacokinetic/Pharmacodynamic Optimization:

      • Determine inhibitor biodistribution in relevant tissues

      • Establish dosing regimens achieving effective concentrations at infection sites

      • Measure inhibitor stability and half-life in vivo

      • Assess potential for host metabolism of inhibitor compounds

    • Delivery System Development:

      • Formulate inhibitors for appropriate administration routes

      • Design targeted delivery systems (e.g., nanoparticles)

      • Develop controlled-release formulations for sustained inhibition

      • Engineer intestinal delivery systems for enteric pathogens

  • Virulence Assessment Methodologies:

    • Bacterial Burden Quantification:

      • Culture-based enumeration from infected tissues

      • Real-time in vivo imaging with bioluminescent reporters

      • Tissue-specific PCR quantification

      • Flow cytometry assessment of tissue homogenates

    • Host Response Evaluation:

      • Measure inflammatory cytokine/chemokine profiles

      • Assess tissue damage through histopathology

      • Quantify immune cell recruitment and activation

      • Monitor physiological parameters (temperature, weight, behavior)

    • Bacterial Gene Expression Analysis:

      • In vivo transcriptomics of recovered bacteria

      • Reporter strains for virulence gene expression

      • Proteomics of bacteria isolated from infected tissues

      • Single-cell analysis techniques for population heterogeneity

Virulence ParameterMeasurement MethodExpected Effect of AaeA InhibitionStatistical Approach
Tissue colonizationCFU enumeration1-2 log reductionMann-Whitney test
Invasion capacityGentamicin protection assay50-80% reductionStudent's t-test
Inflammatory responseCytokine multiplex assayDecreased pro-inflammatory cytokinesTwo-way ANOVA
Tissue damageHistopathology scoringReduced epithelial damageKruskal-Wallis test
Survival rateKaplan-Meier analysisImproved survivalLog-rank test
  • Advanced In Vivo Technologies:

    • Intravital Microscopy:

      • Visualize bacterial behavior in living tissues

      • Track interactions with host cells in real-time

      • Monitor effects of inhibitors on bacterial dissemination

      • Assess tissue-specific impacts of AaeA inhibition

    • Multi-Omics Approaches:

      • Integrate host transcriptomics, proteomics, and metabolomics

      • Apply systems biology to understand global impact of AaeA inhibition

      • Identify novel biomarkers of treatment efficacy

      • Discover unexpected consequences of efflux inhibition

Research with similar RND-type efflux systems has demonstrated that inhibitors can attenuate bacterial virulence in vivo and diminish the intracellular invasion capacity of pathogens, suggesting that targeting AaeA could have significant impacts beyond direct antibiotic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.