Recombinant Salmonella dublin Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Enzyme Characteristics and Function

Phosphoglycerol transferase I (EC 2.7.8.20) facilitates the transfer of phosphoglycerol from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) . In Salmonella dublin, this enzyme is essential for maintaining membrane integrity under osmotic stress. Key features include:

  • Gene Locus: mdoB (also annotated as opgB or strain-specific identifiers like SeD_A4955) .

  • Catalytic Role: Integral to synthesizing osmoregulated glucans, which stabilize bacterial cells in fluctuating environments .

Recombinant Production

Recombinant mdoB is expressed in heterologous systems for biochemical and structural studies. Key production parameters are summarized below:

Table 1: Recombinant Salmonella dublin mdoB Variants

Recombinant Protein SourceGene NamesHost SystemPurity
Salmonella dublin mdoBmdoB, opgBE. coli, Yeast, Baculovirus, Mammalian≥85%
Salmonella paratyphi B mdoBSPAB_05714, mdoBE. coli or Mammalian≥85%
Escherichia coli O139:H28 mdoBECSE_4635, mdoBE. coli or Yeast≥85%

Notes:

  • Host Flexibility: Expressed in multiple systems, enabling scalability for industrial or research applications .

  • Purity: Validated via SDS-PAGE, ensuring suitability for functional assays .

Research Applications

Recombinant mdoB is utilized in:

  1. Mechanistic Studies: Elucidating osmotic stress responses in Salmonella .

  2. Antimicrobial Development: Targeting MDO biosynthesis pathways to disrupt bacterial survival .

  3. Comparative Genomics: Analyzing mdoB divergence across Enterobacteriaceae (e.g., E. coli vs. Salmonella) .

Implications for Salmonella Pathogenesis

While mdoB itself is not a virulence factor, its role in membrane stability indirectly supports Salmonella dublin’s resilience in host environments . Genomic studies highlight mdoB conservation among bovine-adapted Salmonella strains, suggesting evolutionary optimization for host persistence .

Future Directions

  • Structural Resolution: Cryo-EM or crystallography to map active sites.

  • Inhibitor Screening: High-throughput assays to identify mdoB-specific antagonists.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
mdoB; opgB; SeD_A4955; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIALALVAVFGALGWVLRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQMRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDGKPNQS FSAVSCSQENIAEFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPD IIRLWNFPKEIKDFTVDRDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWIDRCYKMAQLWAPALALSTDWCVSQGQLGGQQTVQHVDKAQWKGKTAFKE TVIDVTRYQGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTITLHFNNP TDANTLVIAPPAPVSTNEGNILGHSPRKLGIGMVEIKVVNVES
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Phosphoglycerol Transferase I (mdoB) in Salmonella dublin?

Phosphoglycerol Transferase I (mdoB) in Salmonella dublin is an enzyme that catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides. This enzyme (EC 2.7.8.20) plays a critical role in membrane biology by modifying membrane-derived oligosaccharides with phosphoglycerol residues, creating phosphoglycerol diester derivatives. The enzyme has its active site located on the outer aspect of the inner bacterial membrane, allowing it to interact with substrates in the periplasmic space .

The functional importance of mdoB can be understood through genetic studies, which have shown that mutations affecting this enzyme result in the synthesis of membrane-derived oligosaccharides lacking phosphoglycerol residues. This modification of membrane components likely contributes to membrane integrity, permeability, and potentially to bacterial survival under various environmental conditions.

How does the structure of Salmonella dublin mdoB compare to homologous proteins in other bacterial species?

The Phosphoglycerol Transferase I protein from Salmonella dublin shares structural similarities with homologous proteins from related enterobacteria, particularly Escherichia coli. According to computed structure models, the Salmonella dublin mdoB (UniProt: B5FTA1) has a pLDDT (predicted Local Distance Difference Test) global score of 90.89, indicating very high confidence in the predicted structure .

The protein consists of 763 amino acids with distinct structural domains that contribute to its membrane localization and enzymatic activity. When comparing the sequence and structure to the well-studied E. coli version, several conserved regions can be identified that are likely essential for catalytic function.

Structural analysis methods include:

  • Computational prediction using AlphaFold DB (as seen in the model released in 2021)

  • Comparative structural biology approaches

  • Sequence alignment with homologous proteins to identify conserved domains

The structural features that differentiate Salmonella dublin mdoB from other species may provide insights into host adaptation mechanisms and pathogenicity.

What are the recommended methods for purifying recombinant Salmonella dublin mdoB?

Purification of recombinant Salmonella dublin Phosphoglycerol Transferase I typically involves a multi-step process optimized for membrane proteins:

  • Expression system selection: The protein is commonly expressed in E. coli with an N-terminal His-tag to facilitate purification .

  • Cell lysis and membrane fraction isolation:

    • Mechanical disruption (sonication or French press)

    • Differential centrifugation to separate membrane fractions

    • Careful solubilization using detergents that maintain protein structure and activity

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Gradual elution with imidazole buffer gradients

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Quality control:

    • SDS-PAGE to confirm purity (>90% is typically considered acceptable)

    • Western blotting to confirm identity

    • Activity assays to confirm functional integrity

For storage, the purified protein is typically maintained in a buffer containing 6% trehalose at pH 8.0, and aliquoted to avoid repeated freeze-thaw cycles . For long-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended.

How does mdoB contribute to Salmonella dublin pathogenicity and host adaptation?

Phosphoglycerol Transferase I potentially contributes to S. dublin's pathogenicity through several mechanisms:

  • Membrane integrity modification: The enzyme's role in modifying membrane-derived oligosaccharides may alter the bacterial membrane composition, potentially affecting interactions with host cells and resistance to host defense mechanisms.

  • Connection to virulence plasmids: S. dublin harbors distinct plasmid types including virulence, resistance, and hybrid plasmids that carry unique compositions of virulence genes . The potential interplay between mdoB function and plasmid-encoded virulence factors represents an important area for investigation.

  • Host adaptation mechanisms: As S. dublin is a host-adapted serotype predominantly found in cattle , membrane modifications by mdoB may contribute to this adaptation. The cattle-adapted characteristic of S. dublin is believed to be of recent evolutionary origin, as indicated by multilocus enzyme genotype uniformity and fliC flagellin DNA sequence analysis .

  • Survival in specific host environments: The enzyme may promote bacterial survival in specific host niches by modifying the cell surface in response to environmental cues within the bovine host.

Research approaches to study these connections include:

  • Creation of mdoB knockout mutants and assessment of virulence in animal models

  • Transcriptomic analysis of mdoB expression during different stages of infection

  • Comparative genomic studies across different Salmonella serovars

What experimental approaches are recommended for characterizing the enzymatic activity of recombinant Salmonella dublin mdoB?

To characterize the enzymatic activity of recombinant Salmonella dublin mdoB, researchers should consider these methodological approaches:

  • In vitro activity assays:

    • Measure the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides

    • Utilize model substrates such as arbutin (p-hydroxyphenyl-β-D-glucoside) as described for E. coli phosphoglycerol transferase I

    • Quantify reaction products (phosphoglycerol diester derivatives and sn-1,2-diglyceride) using chromatographic techniques

  • Kinetic parameter determination:

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km, Vmax, and kcat values

    • Determine optimal pH, temperature, and ionic strength conditions

  • Substrate specificity analysis:

    • Test various phospholipid donors beyond phosphatidylglycerol

    • Examine acceptor substrate preferences using synthetic and natural oligosaccharides

    • Perform competitive inhibition studies

  • Structure-function relationships:

    • Utilize site-directed mutagenesis to modify key residues predicted to be involved in catalysis

    • Assess activity changes resulting from mutations

    • Correlate with structural information from the computed mdoB model (pLDDT score 90.89)

  • Membrane reconstitution experiments:

    • Incorporate purified mdoB into liposomes or nanodiscs

    • Assess activity in membrane-mimetic environments

    • Compare with detergent-solubilized enzyme activity

How might recombinant mdoB be utilized to study antimicrobial resistance mechanisms in Salmonella dublin?

Recombinant mdoB can serve as a valuable tool for investigating antimicrobial resistance mechanisms in Salmonella dublin through several research approaches:

  • Membrane modification studies:

    • Investigate how mdoB-mediated membrane modifications affect antibiotic penetration

    • Determine if phosphoglycerol addition to membrane oligosaccharides influences membrane permeability to antimicrobials

  • Integration with known resistance pathways:

    • S. dublin isolates exhibit high levels of multidrug resistance, particularly to ampicillin (87%), ceftiofur (89%), chlortetracycline (94%), oxytetracycline (94%), enrofloxacin (17%), florfenicol (94%), sulfadimethoxine (97%), and trimethoprim (20%)

    • Study potential interactions between mdoB activity and expression of resistance genes such as blaTEM and blaCMY-2

  • Experimental design approaches:

    • Create recombinant S. dublin strains with modulated mdoB expression levels

    • Measure minimum inhibitory concentrations (MICs) of various antibiotics in these strains

    • Analyze membrane composition changes and correlate with resistance profiles

  • Temporal expression analysis:

    • Monitor mdoB expression during antibiotic exposure using RT-qPCR

    • Determine if mdoB is upregulated as part of stress response to antimicrobials

  • Potential therapeutic target assessment:

    • Evaluate if inhibition of mdoB activity could enhance antibiotic efficacy

    • Screen for small molecule inhibitors of the recombinant enzyme

A comprehensive study would combine these approaches with whole genome sequencing analysis to contextualize mdoB's role within the broader resistome of S. dublin.

What is the current understanding of mdoB gene regulation in Salmonella dublin under different environmental conditions?

The regulation of mdoB expression in Salmonella dublin under varying environmental conditions remains an area requiring further investigation. Based on knowledge of related systems, several key aspects can be explored:

  • Osmotic pressure response:

    • Membrane-derived oligosaccharides are known to respond to osmotic changes

    • Study mdoB expression and activity under varying osmolarity conditions that mimic different host environments

  • Temperature-dependent regulation:

    • Compare mdoB expression at bovine body temperature (38.5°C) versus environmental temperatures

    • Identify potential temperature-responsive regulatory elements in the mdoB promoter region

  • Nutrient availability effects:

    • Measure expression changes in nutrient-rich versus nutrient-limited conditions

    • Identify metabolic signals that may influence mdoB expression

  • Host-induced expression changes:

    • Compare mdoB expression in laboratory media versus during infection of bovine cells

    • Utilize ex vivo models with bovine tissue to measure mdoB regulation

  • Methodological approaches for study:

    • Transcriptomics: RNA-seq analysis under various conditions

    • Promoter fusion studies: mdoB promoter fused to reporter genes

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the mdoB promoter

    • Proteomics: measure mdoB protein levels in different conditions

Understanding these regulatory mechanisms could provide insights into how S. dublin adapts to different environmental niches, particularly during the transition from environmental reservoirs to bovine hosts, where it causes significant disease with mortality rates between 2.3% and 18.2% .

How can molecular dynamics simulations enhance our understanding of mdoB function in membrane environments?

Molecular dynamics (MD) simulations offer powerful approaches to study the function of mdoB in membrane environments:

  • Membrane protein-lipid interactions:

    • Simulate mdoB within a phospholipid bilayer mimicking the Salmonella inner membrane

    • Analyze specific interactions between protein residues and membrane lipids

    • Identify potential lipid binding sites that may regulate enzyme activity

  • Substrate binding and catalytic mechanisms:

    • Model the binding of phosphatidylglycerol substrate and membrane-derived oligosaccharides

    • Simulate the phosphoglycerol transfer reaction pathway

    • Calculate energy barriers for catalytic steps

  • Conformational dynamics analysis:

    • Track protein conformational changes during the catalytic cycle

    • Identify mobile regions that may facilitate substrate binding and product release

    • Compare dynamics in different membrane compositions

  • Integration with experimental data:

    • Use the AlphaFold2-predicted structure (pLDDT score 90.89) as starting point

    • Validate simulation results against experimental measurements

    • Generate testable hypotheses for site-directed mutagenesis experiments

  • Technical considerations:

    • System size: typically 100,000-1,000,000 atoms including protein, membrane, and solvent

    • Simulation time: microsecond-scale simulations to capture relevant dynamics

    • Force fields: CHARMM36 or AMBER lipid14 for membrane simulations

    • Analysis tools: MDAnalysis, GROMACS analysis packages, VMD

These computational approaches can provide atomic-level insights into mdoB function that are difficult to obtain experimentally, particularly regarding the dynamic behavior of this membrane-associated enzyme during catalysis.

What are the most effective heterologous expression systems for producing functional Salmonella dublin mdoB?

Selecting an appropriate expression system is crucial for obtaining functional recombinant Salmonella dublin mdoB. The following systems have demonstrated effectiveness for membrane proteins like mdoB:

  • E. coli-based expression systems:

    • BL21(DE3) and derivatives: The most commonly used system; effective for mdoB expression with N-terminal His-tag

    • C41(DE3) and C43(DE3): Specialized strains for membrane protein expression that reduce toxicity

    • Lemo21(DE3): Allows tunable expression through rhamnose-inducible control of T7 lysozyme levels

  • Expression vector considerations:

    • Promoter selection: T7 promoter with lac operator for IPTG-inducible expression

    • Fusion tags: N-terminal His-tag facilitates purification while maintaining activity

    • Codon optimization: Adjust codon usage to match E. coli preference while preserving critical regions

  • Expression conditions optimization:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction parameters: IPTG concentration (0.1-1.0 mM) and induction timing

    • Media formulation: Specialized media containing glycerol as carbon source

  • Alternative expression systems to consider:

    • Cell-free expression systems: Allow direct incorporation into nanodiscs or liposomes

    • Yeast expression (P. pastoris): For cases where E. coli expression is problematic

  • Expression monitoring:

    • Western blotting to confirm expression

    • GFP fusion constructs to monitor proper membrane integration

    • Activity assays using model substrates like arbutin

A systematic optimization approach testing multiple expression conditions is recommended, as membrane proteins like mdoB often require tailored conditions for functional expression.

What analytical methods are most suitable for investigating mdoB interactions with membrane components?

Investigating interactions between recombinant mdoB and membrane components requires specialized analytical methods:

  • Biophysical techniques:

    • Surface plasmon resonance (SPR): Measure binding kinetics between mdoB and immobilized membrane components

    • Microscale thermophoresis (MST): Detect interactions in solution with minimal sample consumption

    • Isothermal titration calorimetry (ITC): Quantify thermodynamic parameters of binding events

  • Spectroscopic methods:

    • Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or environmentally sensitive probes

    • Circular dichroism (CD): Monitor conformational changes upon membrane interaction

    • FTIR spectroscopy: Analyze changes in protein secondary structure upon membrane binding

  • Structural biology approaches:

    • Cryo-electron microscopy: Visualize mdoB in membrane environments

    • X-ray crystallography: Determine structures of mdoB with bound membrane components

    • NMR spectroscopy: Analyze dynamic interactions in membrane-mimetic environments

  • Membrane model systems:

    • Liposomes: Reconstitute mdoB in defined lipid compositions

    • Nanodiscs: Provide a native-like membrane environment with controlled size

    • Bicelles: Combine advantages of micelles and bilayers for spectroscopic studies

  • Functional assays:

    • Enzymatic activity measurements: Compare activity in different membrane compositions

    • Fluorescence recovery after photobleaching (FRAP): Measure lateral mobility in membranes

    • Lipid binding assays: Using labeled lipids to quantify specific interactions

These methodologies can be combined to develop a comprehensive understanding of how mdoB interacts with membrane components, particularly phosphatidylglycerol, its donor substrate, and how these interactions influence enzymatic activity in the bacterial membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.