Recombinant Salmonella dublin Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Role in Antimicrobial Resistance and Virulence

ArnE-mediated L-Ara4N incorporation into LPS is linked to multidrug resistance (MDR) in Salmonella Dublin:

  • AMR Association: Hybrid plasmids in S. Dublin ST10 strains carry both spv virulence operons and AMR genes (e.g., resistance to ampicillin, cephalosporins) . ArnE supports the survival of these strains under antibiotic pressure by modifying lipid A .

  • Virulence: The spv operon on virulence plasmids enhances systemic infection severity, while ArnE/ArnF ensure membrane stability during host invasion .

Research Applications

Recombinant ArnE is utilized in:

  • Mechanistic Studies: Elucidating L-Ara4N transfer kinetics and lipid A modification pathways .

  • Drug Development: Screening inhibitors targeting lipid A biosynthesis to counteract AMR .

  • Vaccine Research: Attenuated S. Dublin strains lacking virulence genes (e.g., spiC, aroA) are being tested as live vaccines, with ArnE as a potential antigen .

Comparative Analysis of ArnE and ArnF

FeatureArnEArnF
Gene NamearnEarnF
FunctionFlippase subunit (translocation)Flippase subunit (membrane stabilization)
Plasmid LinkRarely linked to AMR plasmidsCo-occurrence with spv virulence plasmids
ConservationHigh in EnterobacteriaceaeHigh in Enterobacteriaceae

Recent Findings

  • Hybrid Plasmids: North American S. Dublin ST10 strains harbor IncX1/IncFII(S) plasmids combining spv and AMR genes, with ArnE/ArnF maintaining lipid A modification under antibiotic stress .

  • Synthetic Analog Studies: Phosphodiester-linked L-Ara4N analogs have been synthesized to probe ArnT transferase activity, indirectly validating ArnE’s role in substrate trafficking .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; SeD_A2646; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
arnE
Target Protein Sequence
MIGVILVLASLLSVGGQLCQKQATRPLTVGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWFGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnE protein and what is its function in Salmonella Dublin?

The ArnE protein in Salmonella Dublin functions as a subunit of the 4-amino-4-deoxy-L-arabinose (L-Ara4N) phosphoundecaprenol flippase complex. This complex is responsible for translocating L-Ara4N modifications from the cytoplasmic to the periplasmic side of the inner membrane during lipopolysaccharide (LPS) modification. These modifications alter the charge of the bacterial outer membrane, reducing the binding affinity of cationic antimicrobial peptides and certain antibiotics.

Salmonella Dublin has been shown to possess multiple mechanisms for antimicrobial resistance, including the production of enzymes that degrade or modify antimicrobial agents, membrane impermeability, activation of antimicrobial efflux pumps, modification of cellular targets for antibiotics, and biofilm formation . The ArnE subunit is specifically involved in membrane modifications that contribute to the impermeability mechanism.

What is the genomic context of the arnE gene in Salmonella Dublin?

The arnE gene in Salmonella Dublin is typically found in a conserved operon along with other arn genes (arnB, arnC, arnA, arnD, arnT, and arnF) that collectively encode the machinery necessary for LPS modification with L-Ara4N. This operon is regulated by two-component systems that sense environmental conditions, particularly those that mimic host environments or antimicrobial stress.

How do mutations in the arnE gene affect lipopolysaccharide modification and antimicrobial resistance in Salmonella Dublin?

Mutations in the arnE gene can significantly impact the efficiency of L-Ara4N translocation across the inner membrane, affecting the ultimate modification of lipid A with L-Ara4N. Loss-of-function mutations typically lead to increased susceptibility to polymyxins and host antimicrobial peptides, while certain gain-of-function mutations might enhance resistance through increased modification efficiency.

Research methodologies to study these effects include:

  • Site-directed mutagenesis of arnE followed by minimum inhibitory concentration (MIC) determination

  • Mass spectrometry analysis of LPS to quantify L-Ara4N modifications

  • Membrane permeability assays to assess the integrity of the outer membrane

  • Transcriptomic analysis to evaluate compensatory responses to arnE mutations

From a structural biology perspective, mutations affecting the transmembrane domains of ArnE are particularly disruptive, as they can prevent proper assembly of the flippase complex and halt the L-Ara4N modification pathway entirely.

What experimental approaches are most effective for studying the structure-function relationship of recombinant ArnE protein?

Studying the structure-function relationship of recombinant ArnE requires a multidisciplinary approach:

  • Protein Expression and Purification Systems:

    • Expression in E. coli membrane-protein optimized strains (C41/C43)

    • Use of fusion tags (His, GST, MBP) to improve solubility

    • Detergent screening for optimal extraction from membranes

    • Reconstitution into nanodiscs or liposomes for functional studies

  • Structural Analysis Methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for complex visualization

    • NMR for dynamic studies of specific domains

    • Molecular dynamics simulations to model flippase activity

  • Functional Assays:

    • Fluorescent lipid flipping assays in reconstituted systems

    • ATPase activity measurements (if ATP-dependent)

    • In vitro reconstitution of the complete Arn pathway

  • Interaction Studies:

    • Crosslinking mass spectrometry to identify interaction partners

    • Bacterial two-hybrid assays for protein-protein interactions

    • Co-immunoprecipitation with other Arn pathway components

The challenge with membrane proteins like ArnE lies in maintaining their native conformation during purification and analysis, necessitating careful optimization of detergents and reconstitution conditions.

How does the expression of ArnE correlate with virulence and pathogenicity in Salmonella Dublin infections?

ArnE expression has complex relationships with virulence and pathogenicity due to its role in antimicrobial resistance and host adaptation. Salmonella Dublin possesses numerous virulence factors including Salmonella Pathogenicity Islands (SPI-1, SPI-2, SPI-6, SPI-19), the pSDV virulence plasmid, flagella, and fimbriae that collectively contribute to its invasiveness and systemic spread .

The connection between ArnE and virulence can be studied through:

  • In vivo infection models comparing wild-type and arnE knockout strains to assess:

    • Survival in macrophages and neutrophils

    • Intestinal colonization efficiency

    • Systemic spread to liver and spleen

    • Persistence in host tissues

  • Transcriptomic analyses to determine:

    • Co-regulation of arnE with virulence genes

    • Expression patterns during different infection stages

    • Response to host antimicrobial peptides

  • Host-pathogen interaction studies:

    • Neutrophil extracellular trap (NET) resistance assays

    • Complement resistance testing

    • Survival in bile salts and intestinal antimicrobial peptides

Research indicates that LPS modifications mediated by the Arn pathway, including ArnE, contribute significantly to evasion of host immune defenses, particularly resistance to antimicrobial peptides produced by neutrophils and epithelial cells, potentially explaining why Salmonella Dublin can cause persistent infections and has enhanced intracellular proliferation in intestinal and extraintestinal tissues .

What are the optimal conditions for expressing and purifying recombinant Salmonella Dublin ArnE protein for structural studies?

Successful expression and purification of recombinant Salmonella Dublin ArnE requires careful optimization:

Expression System Optimization:

  • Bacterial Expression: E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Vector Selection: pET vectors with tunable induction or arabinose-inducible systems for controlled expression

  • Growth Conditions: Lower temperatures (16-20°C) after induction to improve folding

  • Induction Parameters: Lower IPTG concentrations (0.1-0.5 mM) and extended expression times (16-24 hours)

Purification Strategy:

  • Membrane Isolation: Differential centrifugation followed by sucrose gradient purification

  • Detergent Screening: Systematic testing of mild detergents (DDM, LMNG, DMNG) for extraction

  • Affinity Purification: IMAC using His-tagged constructs with imidazole gradient elution

  • Size Exclusion Chromatography: Final polishing and buffer exchange to remove aggregates

Stability Assessment:

  • Thermal shift assays to identify stabilizing buffer conditions

  • SEC-MALS to confirm monodispersity and proper oligomeric state

  • Circular dichroism to verify secondary structure content

For structural studies, protein quality is paramount, necessitating rigorous quality control at each purification step and immediate use or appropriate storage conditions to prevent degradation.

What genome editing techniques are most effective for studying arnE function in Salmonella Dublin?

Several genome editing approaches can be employed to study arnE function in Salmonella Dublin:

CRISPR-Cas9 Based Methods:

  • Offers precise editing capabilities with minimal off-target effects

  • Can generate clean deletions, insertions, or point mutations

  • Requires optimization of transformation protocols for Salmonella Dublin

  • Challenges include designing sgRNAs with high specificity and efficiency

Lambda Red Recombineering:

  • Well-established method for Salmonella

  • Utilizes homologous recombination with short homology arms

  • Suitable for generating knockout mutants and epitope tagging

  • Requires removal of antibiotic resistance cassettes using FLP recombinase

Allelic Exchange Systems:

  • Two-step process using suicide vectors (e.g., pDS132, pCVD442)

  • Allows marker-free modifications

  • Useful for introducing point mutations or small modifications

  • Requires counter-selection markers (often sacB)

Inducible Expression Systems:

  • Complementation with arabinose or tetracycline-inducible promoters

  • Allows controlled expression for dose-dependent studies

  • Useful for dominant-negative approaches

When studying essential genes or those affecting growth, conditional mutants or depletion strains may be necessary. For transcriptional studies, reporter fusions (lacZ, lux, gfp) can be integrated to monitor arnE expression under various conditions without disrupting the native gene.

How can transcriptomic and proteomic approaches be integrated to understand ArnE regulation in different environmental conditions?

Integrating transcriptomic and proteomic approaches provides comprehensive insights into ArnE regulation:

Multi-omics Experimental Design:

  • Condition Selection:

    • Antimicrobial exposure (polymyxins, cationic peptides)

    • pH variations mimicking host environments

    • Divalent cation limitation (Mg²⁺, Ca²⁺)

    • Growth in macrophage models or serum

  • Transcriptomic Methods:

    • RNA-Seq for global transcriptional changes

    • qRT-PCR for targeted validation

    • RACE for promoter mapping and transcription start sites

    • ChIP-Seq to identify regulatory factor binding sites

  • Proteomic Approaches:

    • LC-MS/MS for global protein abundance

    • SILAC or TMT labeling for quantitative comparisons

    • Phosphoproteomics to detect post-translational modifications

    • Membrane proteomics with specialized extraction protocols

  • Integration Strategies:

    • Correlation analysis between mRNA and protein levels

    • Pathway enrichment analysis combining both datasets

    • Network analysis to identify regulatory hubs

    • Time-course studies to detect regulatory cascades

This integrated approach can reveal post-transcriptional regulation mechanisms and identify environmental signals that trigger ArnE expression. Research has shown that Salmonella Dublin isolates exhibit specific expression patterns related to antimicrobial resistance genes that differ from other Salmonella serovars, suggesting unique regulatory mechanisms that could be explored through these approaches .

How does the structure and function of ArnE differ between Salmonella Dublin and other Salmonella serovars?

Comparative analysis of ArnE between Salmonella Dublin and other serovars reveals important insights into host adaptation and antimicrobial resistance:

Salmonella Dublin exhibits particularly high levels of antimicrobial resistance compared to other serovars, with 98.5% of isolates resistant to more than four antimicrobials . This enhanced resistance may be partly attributed to differences in regulation of the arn operon rather than structural differences in the ArnE protein itself.

Methodological approaches for comparative studies include:

  • Sequence alignment and evolutionary analysis of arnE across serovars

  • Homology modeling to predict structural differences

  • Heterologous expression studies with ArnE from different serovars

  • Chimeric protein construction to identify functionally important regions

Phylogenetic analysis of Salmonella Dublin isolates has identified distinct geographical clades , suggesting possible regional variations in ArnE and associated resistance mechanisms that could be further explored through comparative genomics.

What insights can comparative genomics provide about the evolution of arnE and antimicrobial resistance in Salmonella Dublin?

Comparative genomics offers valuable perspectives on the evolution of arnE and antimicrobial resistance:

Analysis of 197 Danish cattle isolates from 1996 to 2016 identified three major clades of Salmonella Dublin corresponding to distinct geographical regions, with closely related isolates persisting within the same herds for over 20 years . This suggests stable maintenance of core genomic elements, likely including the arn operon.

The presence of resistance genes varies among Salmonella Dublin populations. Danish isolates within one clade were found to harbor two plasmids of IncFII/IncFIB and IncN types, with the latter carrying blaTEM-1, tetA, strA, and strB antibiotic resistance genes . This contrasts with the broader distribution of resistance genes like blaCMY-2 (85.7%), sulf2 and tetA (98.6%), and aph(3'')-Ib and aph(6)-Id (96.4%) observed in other studies .

Methodological approaches include:

  • Whole genome sequencing with long-read technologies for complete genome assembly

  • Pan-genome analysis to identify core vs. accessory genome components

  • Phylogenetic analysis incorporating temporal data for evolutionary rate estimation

  • Selection pressure analysis on arnE and associated genes

  • Plasmid typing and mobility element identification

Regional differences in antimicrobial resistance have been observed, with high resistance rates in the US and China contrasting with lower rates in European countries like Germany and the UK . This geographic variation provides natural experiments for studying the evolution of resistance mechanisms including the Arn pathway.

How does the interaction between ArnE and other proteins in the LPS modification pathway differ between antimicrobial-resistant and susceptible strains?

The interaction dynamics between ArnE and other proteins in the LPS modification pathway can significantly impact antimicrobial resistance:

In resistant strains, protein-protein interactions within the Arn pathway may be optimized for efficient LPS modification, potentially through:

  • Enhanced complex formation between ArnE and ArnF to form functional flippase units

  • Improved coupling with ArnT transferase for efficient L-Ara4N addition to lipid A

  • Altered interactions with regulatory proteins that control pathway expression

In contrast, susceptible strains might exhibit:

  • Suboptimal complex formation reducing flippase efficiency

  • Mutations affecting interaction interfaces between pathway components

  • Altered regulation leading to insufficient expression of pathway components

Methodological approaches to study these differences include:

  • Co-immunoprecipitation with quantitative MS to assess complex formation

  • Bacterial two-hybrid or split-GFP assays to measure interaction strengths

  • Crosslinking mass spectrometry to map interaction interfaces

  • Blue native PAGE to analyze intact membrane protein complexes

  • Microscopy-based approaches (FRET, FLIM) to visualize interactions in vivo

Antimicrobial resistance in Salmonella Dublin involves multiple mechanisms, with the prevalent resistance genes varying by geographical region . Understanding how the Arn pathway components interact differently in these diverse resistance backgrounds could provide insights for developing strategies to combat multidrug resistance.

What emerging technologies can advance our understanding of ArnE function in antimicrobial resistance?

Several cutting-edge technologies show promise for advancing our understanding of ArnE:

Cryo-Electron Microscopy:

  • Enables visualization of membrane protein complexes in near-native states

  • Can reveal ArnE structural conformations during the flipping process

  • Advances in sample preparation and detectors improve resolution for smaller proteins

Single-Molecule Techniques:

  • Fluorescence microscopy to track individual flipping events

  • Magnetic tweezers to measure forces involved in lipid translocation

  • Nanopore recordings to assess electrophysiological properties

Computational Approaches:

  • AlphaFold2 and RoseTTAFold for accurate structure prediction

  • Molecular dynamics simulations with enhanced sampling techniques

  • Systems biology modeling of complete resistance networks

Genetic Engineering Tools:

  • CRISPR interference for tunable gene repression

  • Optogenetic control of ArnE expression

  • Expanded genetic code incorporation for site-specific probes

Microfluidic Systems:

  • High-throughput screening of conditions affecting ArnE function

  • Single-cell analysis of resistance heterogeneity

  • Gradient formation to mimic host environments

These technologies could help address key questions about the dynamics of ArnE-mediated LPS modification and its contribution to the multidrug resistance observed in Salmonella Dublin, where 98.5% of isolates have been found resistant to more than 4 antimicrobials .

How might targeting ArnE function lead to novel therapeutic strategies against multidrug-resistant Salmonella Dublin?

ArnE presents a promising target for combating multidrug-resistant Salmonella Dublin:

Therapeutic Potential:

  • Inhibition of ArnE would sensitize bacteria to polymyxins and host antimicrobial peptides

  • Could restore efficacy of existing antibiotics through combination therapy

  • May reduce virulence and persistence in host tissues

Drug Development Approaches:

  • Structure-Based Design:

    • Virtual screening against predicted ArnE binding pockets

    • Fragment-based drug discovery targeting critical interfaces

    • Peptide mimetics to disrupt protein-protein interactions

  • Phenotypic Screening:

    • High-throughput assays for compounds that sensitize to polymyxins

    • Whole-cell screening with reporter systems linked to the arn pathway

    • Ex vivo infection models to identify compounds effective in host contexts

  • Alternative Strategies:

    • Antisense oligonucleotides targeting arnE mRNA

    • CRISPR-Cas delivery systems for targeted gene disruption

    • Immunomodulatory approaches enhancing host defense peptide production

The clinical significance of such approaches is substantial, as Salmonella Dublin has become one of the most multidrug-resistant serotypes in the United States, with high resistance to sulfonamides (96%), tetracyclines (97%), aminoglycosides (95%), and beta-lactams (85%) . Targeting conserved resistance mechanisms like the Arn pathway could provide much-needed alternatives for treatment.

What are the implications of ArnE-mediated resistance mechanisms for Salmonella Dublin surveillance and control in cattle production systems?

Understanding ArnE-mediated resistance has important implications for surveillance and control:

Surveillance Applications:

  • Development of molecular diagnostics targeting arnE expression patterns

  • Monitoring of LPS modifications as markers for emerging resistance

  • Integration of ArnE sequence variations into genomic surveillance programs

Control Strategies:

  • Farm-Level Interventions:

    • Targeted antimicrobial stewardship based on resistance mechanism knowledge

    • Enhanced biosecurity measures to prevent transmission of resistant strains

    • Vaccination strategies accounting for ArnE-mediated immune evasion

  • Diagnostic Improvements:

    • Rapid tests for predicting resistance profiles based on genetic markers

    • Environmental sampling protocols optimized for detecting resistant variants

    • Phenotypic assays correlated with ArnE activity levels

  • Policy Implications:

    • Evidence-based restrictions on antimicrobial use in cattle

    • Surveillance requirements incorporating molecular characterization

    • Cross-border control measures based on resistance profiles

Studies have shown that Salmonella Dublin can persist within the same herd and circulate between epidemiologically linked herds for over 20 years . This persistence, combined with the high levels of multidrug resistance, underscores the importance of improved internal and external biosecurity in cattle herds, alongside more sophisticated surveillance approaches that account for resistance mechanisms like those involving ArnE.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.