Recombinant Salmonella dublin Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; SeD_A1593; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIVCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is the yciB protein sequence across different Salmonella serovars?

The yciB protein sequence shows high conservation across different Salmonella serovars, with minimal variations. Comparative analysis of yciB sequences from Salmonella dublin (strain CT_02021853, UniProt: B5FU57), Salmonella newport (strain SL254, UniProt: B4SUC4), and Salmonella paratyphi A demonstrates remarkable sequence homology .

One notable difference appears in position 143, where S. dublin contains valine (V) while S. newport contains alanine (A) in the sequence fragment "LAWALFFIXCGLANIYIAFWLPQN" (where X represents the variable amino acid) . This high degree of conservation suggests evolutionary pressure to maintain yciB function across different Salmonella serovars, indicating its potential importance in core bacterial processes.

What are recommended protocols for recombinant expression and purification of yciB?

For recombinant expression of Salmonella dublin yciB protein, researchers should consider the following methodological approach:

  • Expression System Selection: Due to the membrane-associated nature of yciB, an E. coli expression system with specialized capabilities for membrane protein expression is recommended. The C41(DE3) or C43(DE3) strains, derivatives of BL21(DE3), are particularly suitable as they're engineered to handle potentially toxic membrane proteins.

  • Expression Vector Design:

    • Include an appropriate tag (His6 or GST) for purification

    • Consider using a fusion partner to enhance solubility

    • Incorporate a precision protease cleavage site for tag removal

  • Purification Protocol:

    • Store in Tris-based buffer with 50% glycerol as indicated in product specifications

    • Maintain storage at -20°C, with long-term storage at -80°C

    • Prepare working aliquots at 4°C with usage within one week to prevent protein degradation

    • Avoid repeated freeze-thaw cycles

For functional studies, researchers should note that the recombinant protein may require proper refolding into its native conformation, particularly if inclusion bodies form during expression.

What experimental systems are suitable for studying yciB function in the context of Salmonella dublin pathogenesis?

For investigating yciB function in S. dublin pathogenesis, researchers should consider these experimental approaches:

  • Gene Knockout Studies: Creating yciB deletion mutants in S. dublin to assess changes in:

    • Bacterial growth and morphology

    • Cell division dynamics

    • Virulence in infection models

  • Animal Models:

    • Bovine models would be most relevant as S. dublin is host-adapted to cattle

    • Murine models can serve as alternative systems to study systemic infection

  • Cell Culture Systems:

    • Intestinal epithelial cell lines to study initial invasion

    • Macrophage cell lines to study intracellular survival and replication

    • These systems align with S. dublin's known pathogenic mechanisms involving invasion and intracellular survival

  • In vivo Expression Analysis:

    • Recombinase-based in vivo expression systems similar to those used by Huang et al. can identify if yciB is specifically expressed during infection

    • Analysis of yciB expression in different anatomical sites and infection stages

What is the potential role of yciB in Salmonella dublin virulence and host adaptation?

The role of yciB in S. dublin virulence appears to be linked to intracellular processes that may affect bacterial survival within host cells. While the search results don't provide direct evidence of yciB's specific role in virulence, several aspects warrant investigation:

  • Potential Involvement in Pathogenicity: As S. dublin is a host-adapted, invasive non-typhoidal Salmonella that causes bloodstream infections , the intracellular septation function of yciB may be critical for bacterial replication within host cells. Invasive bacteria must replicate efficiently within host environments, and proteins involved in septation would be crucial for this process.

  • Host Adaptation Mechanisms: The comprehensive study by Jiang et al. (2024) highlighted distinct populations of S. Dublin circulating in different geographical regions with various adaptation mechanisms . The potential contribution of yciB to these adaptation processes should be explored, particularly in the context of the North American cluster that emerged approximately 60 years ago.

  • Connection to Virulence Mechanisms: S. Dublin employs Type III Secretion Systems (TTSS) encoded by Salmonella Pathogenicity Islands (SPIs) for virulence . Research should investigate whether yciB interacts with or modulates these virulence mechanisms, particularly in relation to intracellular survival strategies.

How might yciB expression be regulated in response to environmental cues during infection?

Based on related Salmonella research, yciB expression regulation likely responds to specific environmental signals encountered during infection:

  • Environmental Signal Response: Huang et al. demonstrated that some in vivo-expressed Salmonella genes respond to environmental cues such as high temperature, osmolarity, and formate concentration . Research should investigate whether yciB expression is similarly modulated by:

    • pH changes (particularly acidic environments as found in the distal ileum)

    • Osmolarity shifts (as encountered during transit through the gastrointestinal tract)

    • Formate concentration (which was identified as a significant environmental signal for invasion gene expression)

  • Transcriptional Regulation:

    • Investigation of transcriptional regulators controlling yciB expression

    • Analysis of promoter regions for binding sites of known virulence regulators (e.g., PhoP/PhoQ, BarA/SirA)

    • Potential co-regulation with other virulence factors

  • Temporal Expression Patterns:

    • Expression profiling of yciB across different infection stages

    • Comparison between expression in vitro and in vivo using techniques similar to the recombinase-based in vivo expression system described by Huang et al.

What is the potential relationship between yciB and antimicrobial resistance in Salmonella dublin?

Recent research indicates increasing prevalence of antimicrobial resistance (AMR) in S. Dublin, highlighting the potential importance of investigating yciB in this context :

  • Association with AMR Mechanisms: The study by do Amarante et al. (2025) found that 48.9% of S. Dublin isolates from a farm with a history of outbreaks were classified as multidrug-resistant, showing resistance to penicillin (48.9%), tetracyclines (42.2%), and fluoroquinolones (33.3%) . Research should investigate whether yciB expression is altered in these resistant strains.

  • Potential Contribution to Resistance:

    • Cell division proteins like yciB may influence bacterial growth rate, potentially affecting susceptibility to antibiotics that target dividing cells

    • Changes in membrane-associated proteins could potentially affect permeability to antimicrobials

    • Investigation of yciB mutations or expression level changes in resistant vs. susceptible strains

  • Novel Hybrid Plasmids: The discovery of a novel hybrid plasmid encoding both AMR and mercuric resistance in Australian S. Dublin lineages raises questions about whether genes like yciB might be co-regulated with these resistance elements or play a role in their maintenance.

Could yciB serve as a potential diagnostic marker or therapeutic target for S. dublin infections?

The potential of yciB as a diagnostic marker or therapeutic target should be evaluated based on:

  • Diagnostic Applications:

    • Development of antibody-based detection methods targeting yciB

    • Evaluation of yciB expression during different infection stages to determine optimal detection windows

    • Assessment of conservation across clinical isolates to ensure broad applicability

  • Therapeutic Target Assessment:

    CriteriaEvaluation for yciB
    EssentialityResearch needed to determine if yciB is essential for S. dublin viability or virulence
    AccessibilityAs a membrane protein, yciB may be accessible to antibodies or small molecule inhibitors
    ConservationHigh conservation across Salmonella serovars suggests a core function
    Host homologyLow homology to host proteins would reduce off-target effects
    Structural uniquenessDetailed structural studies needed to identify targetable features
  • Vaccine Development Considerations:

    • Evaluation of yciB immunogenicity

    • Investigation of protective antibody responses

    • Potential for inclusion in subunit vaccine formulations

What are the challenges and solutions for structural characterization of yciB protein?

As a membrane protein, yciB presents specific challenges for structural characterization:

  • X-ray Crystallography Challenges:

    • Difficulty in obtaining sufficient quantities of purified, correctly folded protein

    • Challenges in crystallizing membrane proteins due to hydrophobic regions

    • Solution: Consider using fusion partners specifically designed for membrane protein crystallization, such as T4 lysozyme or BRIL

  • Cryo-EM Approaches:

    • May be more suitable for structural determination without crystallization

    • Challenge: Small size of yciB (179 amino acids) may limit resolution

    • Solution: Consider using Fab fragments as fiducial markers to increase effective size

  • NMR Spectroscopy:

    • Useful for studying protein dynamics and interactions

    • Challenge: Requires isotopic labeling and optimization for membrane proteins

    • Solution: Expression in minimal media with 15N and 13C isotopes, followed by detergent optimization

What methods are most appropriate for investigating yciB interactions with other bacterial proteins?

To investigate protein-protein interactions involving yciB, researchers should consider:

  • Co-immunoprecipitation (Co-IP):

    • Using anti-yciB antibodies to pull down interaction partners

    • Followed by mass spectrometry identification of co-precipitated proteins

    • Challenge: Requires maintaining native membrane environment during extraction

  • Bacterial Two-Hybrid Systems:

    • Adapted for membrane proteins such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid)

    • Allows screening of interaction partners in a bacterial context

    • Particularly useful for identifying interactions with other division proteins

  • Proximity Labeling Approaches:

    • BioID or APEX2 fusion to yciB to biotinylate proximal proteins in vivo

    • Followed by streptavidin pulldown and mass spectrometry

    • Advantage: Can identify transient interactions and spatial proximity in the native cellular context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.