Recombinant Salmonella dublin Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella dublin Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Salmonella dublin Probable ubiquinone biosynthesis protein UbiB (ubiB) is a protein involved in the biosynthesis of ubiquinone, also known as coenzyme Q (CoQ), in bacteria. Ubiquinone plays a crucial role in the electron transport chain and is essential for energy production in cells. The UbiB protein is part of a larger family of proteins involved in CoQ biosynthesis and has been identified in various bacterial species, including Escherichia coli and Salmonella dublin.

Role of UbiB in Coenzyme Q Biosynthesis

UbiB is required for the first monooxygenase step in CoQ biosynthesis. This step involves the conversion of octaprenylphenol into a more complex intermediate that eventually leads to the formation of CoQ. In Escherichia coli, UbiB is encoded by the yigR gene and is part of an operon that includes ubiE and yigP genes, which are also essential for CoQ and menaquinone synthesis .

GeneFunction in CoQ Biosynthesis
ubiEC-methyltransferase for CoQ and menaquinone synthesis
yigPUnknown specific role, part of the operon
ubiB (yigR)First monooxygenase step in CoQ biosynthesis

Recombinant UbiB Protein Applications

Recombinant UbiB proteins are produced using genetic engineering techniques where the ubiB gene is cloned into an expression vector and expressed in a suitable host organism. These proteins are used in various applications:

  • Research: To study the mechanisms of CoQ biosynthesis and its regulation.

  • Diagnostics: In ELISA kits for detecting antibodies or antigens related to UbiB.

  • Biotechnology: Potential applications in improving bacterial strains for biotechnological purposes.

ApplicationDescription
ResearchStudying CoQ biosynthesis mechanisms
DiagnosticsELISA kits for detecting UbiB-related antibodies or antigens
BiotechnologyImproving bacterial strains for industrial applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; SeD_A4359; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of UbiB in bacterial systems including Salmonella Dublin?

UbiB (identified as yigR in E. coli) is required for the first monooxygenase step in coenzyme Q (CoQ) biosynthesis . This protein plays a critical role in the electron transport chain by facilitating ubiquinone production, which is essential for aerobic respiration. In E. coli, ubiB is the third gene in an operon containing ubiE, yigP, and ubiB (yigR) . Disruption of this gene leads to an accumulation of octaprenylphenol, an intermediate in the CoQ biosynthesis pathway .

How might UbiB expression relate to S. Dublin virulence and pathogenicity?

While direct evidence linking UbiB to S. Dublin virulence is limited in the provided literature, metabolic proteins often indirectly affect virulence. S. Dublin is known to cause both intestinal and systemic infections in cattle and presents a serious risk to human health . The bacterium's ability to produce energy efficiently through aerobic respiration (facilitated by UbiB) likely impacts its ability to colonize and persist within host tissues. Research on other Salmonella serovars suggests that deficiencies in energy metabolism can attenuate virulence.

What genomic features characterize the ubiB gene in the context of Salmonella pathogenicity?

The ubiB gene belongs to a predicted protein kinase family . In E. coli, it exists within an operon structure alongside ubiE (encoding a C-methyltransferase required for both CoQ and menaquinone synthesis) and yigP . Mutations affecting this operon can have polar effects on downstream genes, as demonstrated when an IS1 element insertion in ubiE affected ubiB expression in E. coli strain AN59 .

What experimental design principles should be applied when studying recombinant UbiB in S. Dublin?

When designing experiments involving recombinant UbiB, researchers should implement:

  • Factorial designs that account for multiple variables and their interactions

  • Blocking to control for batch effects and other confounding variables

  • Adequate biological replicates (minimum of 5 per group is recommended)5

  • Balanced design with equivalent sample sizes across groups

  • Randomization to minimize bias

  • Appropriate controls for each experimental condition

Researchers should avoid common design pitfalls including:

  • Unbalanced designs (e.g., 20 samples in one group and 5 in another)

  • Inadequate control for batch effects

  • Confounding variables that cannot be separated in analysis

  • Incomplete factorial designs where important sources of variability are omitted5

What methods are most appropriate for generating recombinant S. Dublin strains expressing UbiB variants?

Based on bacterial genetics principles, researchers should consider:

MethodAdvantagesLimitations
Allelic exchangeChromosomal integration, native expression levelsLabor-intensive, strain-specific optimization required
Plasmid-based expressionRapid implementation, control over expression levelsPlasmid stability issues, non-physiological expression
CRISPR-Cas9 genome editingPrecise modifications, no antibiotic markers requiredRequires optimization of guide RNAs, PAM sites
Complementation studiesFunctional validation, physiological relevanceRequires construction of clean deletion mutants

How should researchers assess UbiB functionality in recombinant S. Dublin strains?

Assessment should include:

  • Biochemical approaches:

    • HPLC or mass spectrometry measurement of ubiquinone levels

    • Octaprenylphenol accumulation analysis (the intermediate that accumulates in ubiB mutants)

    • Enzyme activity assays for CoQ biosynthesis

  • Genetic approaches:

    • Complementation studies in ubiB mutant strains

    • Expression analysis using qRT-PCR and protein detection

  • Physiological approaches:

    • Growth kinetics under aerobic vs. anaerobic conditions

    • Oxygen consumption rates

    • Electron transport chain activity measurements

How might UbiB function intersect with antimicrobial resistance mechanisms in S. Dublin?

S. Dublin isolates have been found to harbor plasmids carrying antimicrobial resistance genes . A specific 49-kb IncN plasmid identified in Danish S. Dublin isolates carries resistance genes (blaTEM-1, tetA, strA, strB) and confers resistance to ampicillin, amoxicillin-clavulanic acid, and tetracycline . The relationship between core metabolism (including ubiquinone biosynthesis) and plasmid-mediated resistance warrants investigation, as energy-dependent mechanisms like efflux pumps require functional electron transport chains for optimal activity.

Recent global studies have shown increasing prevalence of antimicrobial resistance in S. Dublin, with resistant strains more likely to cause bloodstream infections, hospitalization, and death compared to susceptible strains .

What is known about the relationship between UbiB function and S. Dublin persistence in host environments?

S. Dublin has demonstrated remarkable persistence within cattle herds, with closely related isolates circulating within the same herd for over 20 years . While the specific contribution of UbiB to this persistence is not directly addressed in the provided literature, metabolic robustness is likely a contributing factor to long-term survival. Research has shown that Danish cattle isolates cluster in distinct geographical regions, suggesting adaptation to local conditions .

The metabolic versatility conferred by functional ubiquinone biosynthesis may contribute to S. Dublin's ability to persist in various microenvironments within hosts and farm settings.

How does UbiB interact with the host immune response during S. Dublin infection?

Effective immune response against Salmonella requires both humoral and cell-mediated immunity, as the bacterium can survive within macrophages . The role of UbiB in this context includes:

  • Potentially influencing bacterial survival within phagocytes where respiratory metabolism may be critical

  • Possibly affecting expression of bacterial antigens recognized by the immune system

  • Potentially modulating bacterial responses to oxidative stress generated by immune cells

Vaccination strategies targeting S. Dublin must stimulate both antibody production and T cell responses, particularly those producing IFN-γ (Th1) and IL-17 (Th17), which are critical for controlling intracellular Salmonella .

What statistical approaches are most appropriate for analyzing data from UbiB functional studies?

When analyzing data from UbiB functional studies, researchers should:

  • For comparing multiple experimental groups:

    • Use ANOVA with appropriate post-hoc tests for parametric data

    • Consider non-parametric alternatives when assumptions are violated

    • Include relevant covariates using ANCOVA when appropriate

  • For time-course experiments:

    • Apply repeated measures analysis or mixed-effects models

    • Consider time series analysis for complex temporal patterns

  • For gene expression studies:

    • Use specialized statistical packages designed for RNA-seq or microarray data

    • Account for multiple testing corrections (FDR, Bonferroni)

  • For bacterial population studies:

    • Apply phylogenetic analysis methods as used in S. Dublin epidemiological studies

    • Consider population structure when interpreting phenotypic differences

How should researchers interpret heterogeneity in UbiB function across different S. Dublin isolates?

When studying diverse S. Dublin isolates, researchers should consider:

What experimental controls are essential when studying recombinant UbiB in S. Dublin?

Critical controls include:

  • Genetic controls:

    • Wild-type parent strain

    • Clean deletion mutant (ΔubiB)

    • Complemented strain (ΔubiB + ubiB)

    • Vector-only control for plasmid-based studies

  • Expression controls:

    • qRT-PCR to confirm transcription

    • Western blotting to verify protein production

    • Inclusion of tagged variants for detection (ensuring tags don't interfere with function)

  • Functional controls:

    • Known ubiB mutants from related organisms (e.g., E. coli AN59 )

    • Chemical inhibition of ubiquinone biosynthesis as a comparative reference

    • Positive and negative controls for each functional assay

  • Experimental design controls:

    • Accounting for batch effects5

    • Including biological and technical replicates

    • Randomization and blinding where appropriate

How might CRISPR-Cas9 technology advance functional studies of UbiB in S. Dublin?

CRISPR-Cas9 offers several advantages for UbiB research:

  • Creation of precise mutations to study structure-function relationships

  • Development of regulated expression systems to study dosage effects

  • Generation of reporter fusions to study localization and expression dynamics

  • Implementation of CRISPR interference (CRISPRi) for transient knockdown studies

  • Creation of comprehensive mutant libraries targeting UbiB domains

What potential exists for targeting UbiB function as an antimicrobial strategy against S. Dublin?

Given the essential role of ubiquinone in aerobic respiration, UbiB represents a potential target for antimicrobial development:

  • The increasing prevalence of antimicrobial resistance in S. Dublin (particularly in North American isolates ) necessitates novel therapeutic approaches

  • Metabolic targets may present higher barriers to resistance development

  • Targeting UbiB could potentially reduce bacterial persistence within host cells

  • Structure-based drug design could exploit differences between bacterial and host ubiquinone biosynthesis

How might systems biology approaches enhance our understanding of UbiB's role in S. Dublin pathogenesis?

Integration of multiple omics technologies could provide comprehensive insights:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.