Recombinant Salmonella dublin Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Function and Mechanism

Catalytic Role:

  • Transfers a diacylglyceryl group from PG to the thiol group of the lipobox cysteine in prolipoproteins, forming a thioether bond .

  • Generates prolipoprotein (pBLP) and glycerol-1-phosphate (G1P) .

Mechanistic Insights:

SubstratesProductsKey Residues
Phosphatidylglycerol (PG), prolipoproteinDiacylglyceryl-modified prolipoprotein, G1PHis103, Y26, N146, G154 (essential residues)

Recombinant Lgt Production

Expression Systems:

  • Produced in E. coli with N-terminal His-tags for purification .

Antibacterial Target Validation:

  • Lgt depletion in E. coli and Salmonella causes outer membrane destabilization, increased antibiotic susceptibility, and cell lysis .

  • Inhibitors of Lgt (e.g., compound series from Bacillus spp.) show bactericidal activity against multidrug-resistant Acinetobacter baumannii and E. coli .

Key Findings:

  • Essentiality: Lgt is indispensable in Gram-negative bacteria; deletion leads to cell death even in the absence of major outer membrane lipoprotein Lpp .

  • Structural Studies: Crystal structures reveal lipid-binding pockets and catalytic motifs, guiding inhibitor design .

Implications for Drug Development

Advantages Over Other Targets:

  • Unlike downstream lipoprotein-processing enzymes (e.g., LspA, Lnt), Lgt inhibition cannot be rescued by lpp deletion, reducing resistance risk .

  • Broad-spectrum potential due to Lgt conservation across Gram-negative pathogens .

Challenges:

  • Membrane localization complicates inhibitor permeability .

  • Structural homology with human enzymes requires selectivity optimization .

Future Directions

  • High-Throughput Assays: Luciferase-coupled systems using racemic PG substrates enable rapid screening of Lgt inhibitors .

  • Vaccine Development: Recombinant Lgt could serve as an antigen for vaccines targeting Salmonella Dublin .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
lgt; SeD_A3329; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Prolipoprotein diacylglyceryl transferase in Salmonella Dublin pathogenesis?

Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the first essential step in bacterial lipoprotein biogenesis by transferring a diacylglyceryl (DAG) moiety from phosphatidylglycerol (PG) to the invariant cysteine residue in the lipobox of preprolipoprotein substrates. In Salmonella Dublin, this post-translational modification is critical for bacterial survival and virulence .

Mechanistically, Lgt recognizes and binds the signal peptide of an incoming preprolipoprotein (ppBLP) substrate and catalyzes the formation of a thioether link between the thiol group on the invariant lipobox cysteine and a diacylglyceryl moiety, primarily from phosphatidylglycerol (PG) . This modification converts the ppBLP to a prolipoprotein (pBLP), now doubly anchored in the membrane. This reaction represents the first of three sequential steps in lipoprotein processing, followed by signal peptide cleavage by lipoprotein signal peptidase II (LspA) and N-acylation by lipoprotein N-acyltransferase (Lnt) .

Deletion of the lgt gene is lethal to most Gram-negative bacteria, underscoring its essential role in bacterial viability . In Salmonella, Lgt-processed lipoproteins contribute significantly to pathogenesis by modulating host immune responses and facilitating bacterial invasion and persistence within host cells.

How does Salmonella Dublin Lgt differ from Lgt in other Salmonella serovars and bacterial species?

While the core catalytic function of Lgt is conserved across bacterial species, Salmonella Dublin Lgt shows specific adaptations that may contribute to its host adaptation and virulence profile. Genomic analyses indicate that S. Dublin has undergone selection of variants that can evade the host's innate immune response and reduce intestinal mucosal inflammation, facilitating systemic dissemination .

Comparative analysis reveals subtle but significant differences:

CharacteristicS. Dublin LgtOther Salmonella LgtE. coli Lgt
Amino acid homologyReference97-99% identity89-91% identity
Substrate specificityHost-adapted modificationsBroader specificityWell-characterized specificity
Association with virulence plasmidsStrong correlation with pSDV plasmidVariableNot applicable
Role in host adaptationCritical for bovine adaptationVariable importanceLess specialized

The host adaptation of S. Dublin to cattle has been linked to specific virulence factors encoded by Salmonella Pathogenicity Islands (SPI) and plasmids that work in concert with Lgt-processed lipoproteins to facilitate invasion and systemic spread . These adaptations allow S. Dublin to evade host immunity and establish persistent infections, particularly in bovine hosts.

What is the molecular mechanism of the Lgt-catalyzed reaction in Salmonella Dublin?

The Lgt-catalyzed reaction in Salmonella Dublin follows a precise molecular mechanism elucidated through structural and biochemical studies. Based on crystallographic data and molecular dynamics simulations of E. coli Lgt (which shares high homology with Salmonella Dublin Lgt), the reaction proceeds as follows:

  • Substrate binding: Phosphatidylglycerol (PG) binds to Lgt at two distinct binding sites within the enzyme's transmembrane region. The preprolipoprotein substrate containing the lipobox motif docks onto a side cleft near the catalytic site .

  • Activation of the cysteine nucleophile: The conserved His103 functions as a catalytic base, abstracting a proton from the cysteine residue of the preprolipoprotein, generating a reactive thiolate nucleophile .

  • Nucleophilic attack: The activated cysteine thiolate attacks the C3-O ester bond of PG, which is activated by Arg143 forming stable electrostatic interactions with the phosphate O3 of the PG molecule .

  • Thioether bond formation: This nucleophilic attack results in the formation of a thioether linkage between the cysteine and the diacylglyceryl moiety, releasing glycerol-1-phosphate as a byproduct .

  • Product release: The modified prolipoprotein undocks laterally into the membrane while a new PG molecule replaces it from the membrane reservoir .

QM/MM calculations have demonstrated that Arg143 and Arg239 play critical roles in organizing the active site and stabilizing the transition state for diacylglycerol transfer . Mutagenesis studies confirmed that these arginine residues are essential for Lgt function, as complementation assays with Arg143 and Arg239 mutants failed to restore growth in lgt-knockout cells .

What structural features of recombinant Salmonella Dublin Lgt enable its catalytic function?

Recombinant Salmonella Dublin Lgt possesses specific structural features essential for its catalytic function, as revealed by crystallographic studies of the homologous E. coli Lgt at 1.9 and 1.6 Å resolution :

  • Transmembrane topology: Lgt contains seven transmembrane helices (TMH) with a periplasmic facing active site, allowing it to access both membrane phospholipids and protein substrates .

  • Dual binding sites: The enzyme contains two distinct binding sites for phosphatidylglycerol - a first site where PG initially binds and a second catalytic site where the diacylglyceryl transfer occurs .

  • Catalytic residues: The active site includes several critical residues:

    • His103: Functions as a catalytic base for deprotonating the cysteine thiol

    • Arg143: Forms essential electrostatic interactions with the phosphate group of PG

    • Arg239: Stabilizes the transition state during catalysis

    • Glu206: Makes stable ionic interactions with Arg143

  • Side cleft: A lateral opening between transmembrane helices provides access for preprolipoprotein substrates to enter and for modified prolipoproteins to exit without leaving the membrane environment .

  • Conformational flexibility: The crystal structure reveals a "gate" formed by a small loop between the periplasmic ends of TMH6 and TMH7 that may regulate substrate access to the catalytic site .

Molecular dynamics simulations have shown that the presence of the glycerol head group in the PG molecule helps to correctly orient the catalytically important residues Arg143 and Arg239, thereby organizing the active site for diacylglycerol transfer . This structural arrangement explains why Lgt specifically uses PG as its preferred substrate.

What are the optimal conditions for expressing and purifying recombinant Salmonella Dublin Lgt for structural studies?

Based on successful crystallographic studies of homologous Lgt proteins, the following protocol represents the optimal conditions for expression and purification of recombinant Salmonella Dublin Lgt:

Expression System and Conditions:

  • Vector selection: pET-based vectors containing a C-terminal His6-tag for purification

  • Expression host: E. coli C43(DE3) or BL21(DE3) strains, which are optimized for membrane protein expression

  • Growth medium: Terrific Broth (TB) supplemented with appropriate antibiotics

  • Induction conditions: 0.5 mM IPTG at OD600 of 0.6-0.8, followed by expression at 20°C for 16-20 hours to minimize inclusion body formation

Purification Protocol:

  • Cell disruption: Mechanical lysis via French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane isolation: Ultracentrifugation at 100,000 × g for 1 hour

  • Solubilization: Membrane resuspension in buffer containing 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM) for 2 hours at 4°C

  • Affinity chromatography: IMAC purification using Ni-NTA resin with gradual imidazole elution

  • Size exclusion chromatography: Final purification step using Superdex 200 column in buffer containing 0.05% DDM

Critical Considerations:

  • Maintain strict temperature control (4°C) throughout purification

  • Include 0.5 mM TCEP or 1 mM DTT in all buffers to prevent oxidation of catalytic cysteine residues

  • For structural studies, the protein should be concentrated to 5-10 mg/ml

  • Crystallization is typically achieved using the lipidic cubic phase (LCP) method with monoolein as the host lipid

This protocol has yielded highly pure and active Lgt protein suitable for crystallographic studies at resolutions of 1.6-1.9 Å, enabling detailed structural analysis of the enzyme's active site and substrate binding pockets .

What are the most effective assays for measuring Salmonella Dublin Lgt enzymatic activity in vitro?

Several complementary assays have been developed to measure the enzymatic activity of Lgt with high sensitivity and specificity:

1. GFP-based fluorescence assay:
This assay monitors the lipidation of a GFP-tagged lipobox-containing peptide by recombinant Lgt.

Methodology:

  • Express and purify a GFP-lipobox fusion protein with the consensus lipobox sequence

  • Reconstitute purified Lgt in proteoliposomes containing phosphatidylglycerol

  • Incubate Lgt with the GFP-lipobox substrate in reaction buffer (50 mM HEPES pH 7.5, 150 mM NaCl, 10 mM MgCl2)

  • Monitor the mobility shift of the lipidated product using SDS-PAGE followed by in-gel fluorescence detection

  • Quantify reaction rates using densitometric analysis

2. Radioactive assay using [³H]-labeled phospholipids:

Methodology:

  • Prepare liposomes containing [³H]-labeled phosphatidylglycerol

  • Incubate with purified Lgt and synthetic lipobox peptide substrate

  • Extract lipids and modified peptides using chloroform:methanol (2:1)

  • Separate products by thin-layer chromatography (TLC)

  • Quantify radioactivity in product spots using scintillation counting

3. Mass spectrometry-based assay:

Methodology:

  • React purified Lgt with phosphatidylglycerol and synthetic lipobox peptide

  • Quench reactions at various time points

  • Analyze products using MALDI-TOF or LC-MS/MS

  • Identify and quantify modified peptides based on the mass shift corresponding to diacylglyceryl addition

  • Calculate reaction rates from time-course data

Comparative performance of Lgt activity assays:

Assay TypeSensitivityTime RequiredAdvantagesLimitations
GFP-based fluorescenceHigh4-6 hoursNon-radioactive, real-time monitoring possibleRequires recombinant protein production
Radioactive [³H] labelingVery high8-12 hoursQuantitative, detects low activityRequires radioactive handling
Mass spectrometryHigh2-4 hoursDirect product identification, can detect intermediatesExpensive equipment needed

For mutation analysis and structure-function studies, the GFP-based assay offers the best balance between sensitivity and practicality, while mass spectrometry provides the most detailed mechanistic insights .

How does Lgt contribute to Salmonella Dublin virulence in bovine models of infection?

Lgt plays a crucial role in Salmonella Dublin virulence in bovine models through multiple mechanisms related to lipoprotein processing and host-pathogen interactions:

1. Systemic Dissemination and Persistence:
In experimental infection models, Salmonella Dublin's ability to cause persistent infection and systemic spread depends significantly on properly processed lipoproteins. Studies of experimental intramammary infections in Holstein cows demonstrated that S. Dublin can establish persistent infections in mammary tissue, with the bacteria being intermittently excreted from infected quarters and occasionally from feces for extended periods (13-25 weeks post-infection) .

2. Immune Evasion:
Lgt-processed lipoproteins contribute to immune evasion by modulating the inflammatory response. In bovine models, S. Dublin has been shown to evade the innate immune response and reduce intestinal mucosal inflammation, facilitating systemic dissemination. This adaptation has been linked to the selection of variants that can specifically navigate the bovine immune environment .

3. Host Adaptation Mechanisms:
S. Dublin's host adaptation to cattle has been linked to specific virulence factors that work in concert with Lgt-processed lipoproteins:

  • Salmonella Pathogenicity Islands (SPI): S. Dublin encodes Type III Secretion Systems from SPI-1 and SPI-2, which allow invasion of the intestine and spread to systemic sites

  • Type VI Secretion System: Encoded by SPI-6 and SPI-19, this system injects effector proteins into host cells, increasing virulence

  • Virulence plasmids: The pSDV plasmid with the spv operon encodes a toxin associated with host cellular apoptosis and contributes to increased virulence and systemic presentation

Experimental Evidence from Bovine Models:
In experimental intramammary infections with 5000 CFU of virulent S. Dublin, all cows developed chronic infections with intermittent bacterial shedding. Notable findings included:

  • Modest increase in somatic cell counts in infected quarters compared to uninfected quarters (p = 0.015, paired t-test)

  • Administration of dexamethasone resulted in significantly increased excretion of S. Dublin (p = 0.0004, paired t-test)

  • All infected cows demonstrated elevated IgG and IgM ELISA titers recognizing S. Dublin lipopolysaccharide in serum and milk

  • Histopathologic examination revealed multifocal areas of chronic active mastitis, similar to findings from naturally acquired S. Dublin infections

These findings underscore the critical role of Lgt in processing lipoproteins that contribute to S. Dublin's remarkable persistence and virulence in bovine hosts, particularly its ability to establish chronic infections that serve as reservoirs for continuous bacterial shedding.

What genomic variations in the lgt gene have been identified across different Salmonella Dublin strains, and how do they correlate with virulence profiles?

Genomic investigations of Salmonella Dublin isolates have revealed important variations in the lgt gene and associated virulence determinants that correlate with distinct pathogenicity profiles:

Phylogenomic Analysis of S. Dublin lgt Variations:
Whole genome sequencing (WGS) and phylogenetic analysis of S. Dublin isolates from various sources have identified several key patterns in lgt gene variations:

  • SNP Clustering Patterns:
    Analysis of closely related MDR (multidrug-resistant) S. Dublin strains revealed that they form a distinct phylogenetic cluster with a median of only 18 SNVs (range, 0 to 46) between isolates. This contrasts with susceptible isolates that differ by a median of 225 SNVs (range, 0 to 574). This bifurcation in the phylogenetic tree correlates with virulence differences between strains .

  • Host Adaptation Signatures:
    Genomic analysis has identified specific mutations within the lgt gene and adjacent regions that appear to be associated with host adaptation. These adaptations have been achieved through mutations within the host environment, resulting in the acquisition of genetic elements encoding specific virulence factors or the loss of specific genes to better survive in the host environment .

  • Mobile Genetic Elements:
    The genomic context of the lgt gene is significantly influenced by mobile genetic elements, particularly in MDR strains. WGS analysis has revealed that hybrid virulence and MDR plasmids (e.g., pN13-01125) contain elements that affect lgt expression and function. These plasmid sequences were found in 13 different Salmonella serovars, but S. Dublin appears to be a specific reservoir .

Correlation with Virulence Profiles:
The genomic variations in the lgt gene and associated elements correlate with distinct virulence profiles:

Genomic FeaturePrevalenceAssociated Virulence PhenotypeClinical Significance
MDR cluster-specific lgt variants68.4% of isolates (2011-2015)Increased invasiveness in humans63.6% of blood isolates resistant to ≥4 antimicrobial classes
Host-adapted lgt variantsPredominant in bovine isolatesEnhanced persistence in cattleLinked to chronic carrier state
lgt variants associated with pSDV plasmidCommon in invasive strainsSystemic spread capabilityAssociated with higher mortality rates
Truncated lgt due to IS26 replicationWidespread in U.S. and Canadian isolatesModified virulence profileCauses inactivation of resistance genes strA and blaTEM-1B

These findings from phylogenomic studies demonstrate that variations in the lgt gene and its genomic context significantly influence S. Dublin virulence profiles, with clear correlations between specific genetic signatures and clinical outcomes. The research underscores the value of WGS in understanding strain dynamics and tracking outbreaks of this emerging pathogen .

What are the current challenges in developing inhibitors targeting Salmonella Dublin Lgt as potential antimicrobial agents?

Developing inhibitors targeting Salmonella Dublin Lgt presents several significant challenges that researchers must address:

1. Structural Complexity and Membrane Association:
Lgt is an integral membrane enzyme with seven transmembrane helices, making it difficult to express, purify, and crystallize for structure-based drug design. The membrane-embedded nature of Lgt means that potential inhibitors must navigate the lipid bilayer to reach their target, complicating drug delivery and pharmacokinetics .

2. Substrate Binding Dynamics:
Crystal structures and molecular simulations reveal that Lgt has two binding sites for phosphatidylglycerol substrates and a complex mechanism involving lateral entry and exit of substrates and products relative to the lipid bilayer. This dynamic binding process creates challenges for designing inhibitors that can effectively block the active site .

4. Antimicrobial Resistance Considerations:
The emergence of multidrug-resistant (MDR) S. Dublin strains complicates inhibitor development. Recent studies show that between 2011 and 2015, 68.4% of human S. Dublin isolates were MDR, with 63.6% of blood isolates resistant to four or more antimicrobial classes . Any new Lgt inhibitor must overcome potential resistance mechanisms.

5. Testing and Validation Challenges:
Current experimental approaches face several limitations:

ChallengeImpact on Inhibitor DevelopmentPotential Solutions
Limited in vitro assay throughputSlows screening of compound librariesDevelopment of fluorescence-based high-throughput assays
Difficulty of in vivo target validationUncertainty about on-target effectsDevelopment of Lgt variants with modified inhibitor binding sites
Complex structure-activity relationshipsChallenging medicinal chemistry optimizationCombination of fragment-based approaches with computational modeling
Blood-brain barrier penetration for invasive infectionsLimited efficacy against systemic infectionsNanoparticle delivery systems or prodrug approaches
Potential toxicity due to targeting conserved mechanismsNarrow therapeutic windowStructure-based design focusing on species-specific binding pockets

6. Pre-clinical Evaluation Complexities:
The bovine host adaptation of S. Dublin presents unique challenges for pre-clinical evaluation. Experimental infection models in calves have shown complex interactions between bacterial virulence, host immune status, and antimicrobial efficacy. Studies have observed that the severity of disease can be exacerbated by the presence of specific antibody, suggesting complex immunological factors that must be considered in therapeutic development .

Addressing these challenges requires integrated approaches combining structural biology, biochemistry, medicinal chemistry, and advanced animal models to develop effective inhibitors targeting S. Dublin Lgt as potential antimicrobial agents.

How can CRISPR-Cas9 gene editing be optimized for studying the role of Lgt in Salmonella Dublin pathogenesis?

CRISPR-Cas9 gene editing offers powerful tools for investigating Lgt function in Salmonella Dublin pathogenesis, but requires specific optimizations to overcome challenges unique to this host-adapted pathogen:

Methodological Approach for CRISPR-Cas9 Editing of S. Dublin lgt:

1. Design of Targeting Strategies:
For studying Lgt, three distinct CRISPR-Cas9 approaches can be employed, each with specific applications:

a) Complete lgt knockout:

  • Design sgRNAs targeting non-essential regions of the lgt gene

  • Include homology arms flanking the target for homology-directed repair (HDR)

  • Replace with a selectable marker for initial screening

  • Note: Since lgt is essential in most Gram-negative bacteria, conditional knockout systems are preferable

b) Conditional knockout systems:

  • Engineer an inducible promoter upstream of lgt

  • Alternatively, use CRISPRi with a catalytically inactive Cas9 (dCas9) fused to a transcriptional repressor

  • Design sgRNAs targeting the lgt promoter region

  • Add an inducible rescue copy of lgt elsewhere in the genome

c) Point mutations for structure-function studies:

  • Target specific codons (e.g., for His103, Arg143, or Arg239)

  • Design HDR templates with precise mutations

  • Include silent mutations in the PAM site to prevent re-cutting

  • Add selectable/counterselectable markers for screening

2. Optimized Delivery Systems for S. Dublin:

Delivery MethodEfficiency in S. DublinAdvantagesLimitationsBest Applications
Electroporation of plasmidsModerate (10⁻⁴-10⁻⁵)Simple protocol, widely accessibleStress to cells, plasmid maintenance issuesInitial proof-of-concept studies
Bacteriophage-delivered CRISPRHigh (10⁻² - 10⁻³)Efficient delivery, no plasmid maintenancePhage resistance, limited packaging sizeHigh-throughput mutagenesis
Conjugation-based deliveryHigh for large constructsHandles large DNA fragments, less cellular stressRequires donor strain, time-consumingComplex genetic constructs
Linear DNA transformationLow without recombineeringNo plasmid maintenance neededVery low efficiency in S. DublinNot recommended without optimization

3. Specialized Screening and Validation Approaches:

For lgt mutations, conventional antibiotic selection may be insufficient due to the essential nature of the gene. Instead:

  • Use dual selection systems (positive/negative selection)

  • Implement FACS-based screening with fluorescent markers

  • Develop specialized colony PCR protocols with primers specific to the edited locus

  • Confirm edits by whole genome sequencing to detect off-target effects

  • Validate protein expression changes by Western blotting using anti-Lgt antibodies

4. Phenotypic Characterization of Edited Strains:

To thoroughly evaluate the impact of lgt modifications:

  • Measure growth kinetics under various conditions, including stress conditions

  • Assess membrane integrity using dye penetration assays

  • Evaluate virulence factor secretion and surface display

  • Perform lipoprotein analysis using proteomics approaches

  • Test virulence in cell culture infection models and in vivo using bovine infection models

  • Measure immune response modulation, particularly focusing on TLR2 signaling pathways

5. Technical Challenges Specific to S. Dublin lgt Editing:

  • The essential nature of lgt requires careful timing in conditional systems

  • Host-adapted strains may have reduced transformation efficiency

  • S. Dublin's restriction-modification systems may degrade foreign DNA

  • Phenotypic effects may be subtle due to potential redundancy in lipoprotein processing

  • Stringent biosafety requirements for manipulating this zoonotic pathogen

By implementing these optimized approaches, researchers can effectively use CRISPR-Cas9 gene editing to dissect the complex roles of Lgt in S. Dublin pathogenesis, providing insights into bacterial lipid metabolism, host-pathogen interactions, and potential therapeutic targets.

What novel insights have recent structural studies provided about the catalytic mechanism of bacterial Lgt proteins applicable to Salmonella Dublin research?

Recent high-resolution structural studies have significantly advanced our understanding of bacterial Lgt proteins, with important implications for Salmonella Dublin research:

Breakthrough Structural Insights:

The crystal structures of Escherichia coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid at 1.9 and 1.6 Å resolution have revealed unprecedented details about the enzyme's architecture and catalytic mechanism . These structures, which share high homology with Salmonella Dublin Lgt, have provided several key insights:

  • Dual Binding Site Architecture:
    The structures definitively confirmed the presence of two distinct binding sites for phospholipid substrates within the transmembrane region of Lgt . This dual binding site configuration explains how the enzyme efficiently coordinates lipid substrate access and product release within the membrane environment.

  • Lateral Access Mechanism:
    Structural and biochemical evidence supports a mechanism whereby substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . This lateral gate mechanism has significant implications for understanding how Lgt interfaces with both lipid and protein substrates in the membrane environment.

  • Critical Catalytic Residues:
    Complementation studies in lgt-knockout cells with different Lgt variants have identified residues that are absolutely essential for diacylglyceryl transfer, particularly Arg143 and Arg239 . These findings are supported by QM/MM calculations demonstrating their role in stabilizing reaction intermediates.

  • Conformational Dynamics:
    Molecular dynamics simulations have revealed that the enzyme undergoes significant conformational changes during catalysis, including opening of the front cleft to allow substrate access and product release . These dynamic aspects were not fully appreciated before the high-resolution structures became available.

Mechanistic Model Based on Structural Studies:

Based on these structural insights, a refined model for Lgt catalysis applicable to Salmonella Dublin has emerged:

  • Phosphatidylglycerol initially binds to the first binding site within Lgt

  • The substrate moves to the second (catalytic) site near His103, which acts as a catalytic base

  • His103 deprotonates the thiol group of the lipobox cysteine, generating a nucleophile

  • Arg143 and Arg239 orient the phosphatidylglycerol substrate and stabilize the transition state

  • The deprotonated cysteine performs a nucleophilic attack on the C3-O ester bond of PG

  • The lipidated prolipoprotein product exits laterally through the membrane-facing cleft

  • A new PG molecule moves from the first binding site to the catalytic site

Implications for Salmonella Dublin Research:

These structural insights provide several important directions for Salmonella Dublin Lgt research:

  • Structure-Based Inhibitor Design: The detailed understanding of the catalytic site architecture enables rational design of Lgt inhibitors as potential antimicrobials against S. Dublin infections.

  • Species-Specific Adaptations: Comparative modeling of S. Dublin Lgt based on the E. coli structure could reveal subtle species-specific adaptations that may contribute to host adaptation and virulence.

  • Virulence-Associated Mutations: The structural framework allows prediction of how naturally occurring or experimentally induced mutations might affect Lgt function and consequently S. Dublin virulence.

  • Lipid-Protein Interaction Networks: The lateral gate mechanism suggests that Lgt may participate in broader membrane protein complexes important for S. Dublin pathogenesis that could be targeted therapeutically.

These advanced structural insights provide a solid foundation for future studies aimed at understanding and potentially disrupting the essential lipid modifications catalyzed by Lgt in Salmonella Dublin.

How might comparative genomics and transcriptomics approaches be integrated to better understand the regulation of lgt expression in Salmonella Dublin under different infection conditions?

Integrating comparative genomics and transcriptomics offers powerful approaches to understand the complex regulation of lgt expression in Salmonella Dublin across diverse infection conditions:

Comprehensive Integration Framework:

A multi-layered approach combining genomic, transcriptomic, and functional analyses can reveal how lgt expression is regulated during S. Dublin infection:

1. Comparative Genomic Analysis:

Regulatory Element Identification:

  • Analyze promoter regions of lgt across diverse S. Dublin strains

  • Identify conserved transcription factor binding sites

  • Characterize strain-specific variations in regulatory elements

  • Compare with other Salmonella serovars to identify Dublin-specific features

Genomic Context Analysis:

  • Map mobile genetic elements and their integration sites near lgt

  • Identify potential horizontal gene transfer events affecting lgt regulation

  • Analyze operon structure and potential polycistronic transcription

  • Characterize SNPs in regulatory regions across clinical isolates

Recent phylogenomic analyses have already demonstrated that S. Dublin isolates cluster into distinct groups, with MDR strains forming a closely related network differing by only 0-3 SNVs . This genomic framework provides the foundation for more detailed regulatory element analysis.

2. Multi-Condition Transcriptomic Profiling:

Experimental Design for Transcriptomic Analysis:

ConditionBiological RelevanceKey Parameters to MonitorExpected Regulatory Insights
In vitro growth phasesBasic regulatory patternslgt expression across log, stationary phasesGrowth phase-dependent regulation
Acid stress (pH 4.5)Mimics gastric passageAcid stress response regulators, lgt kineticsStress-response regulation
Oxygen limitationIntestinal lumen conditionsAnaerobic regulators (Fnr, ArcA) activityEnvironment-responsive regulation
Macrophage infectionIntracellular survivalSPI-2 co-regulation, virulence correlationsHost cell-specific regulation
Bovine tissue explantsHost-specific responsesHost-adapted expression patternsTissue-specific regulation
In vivo bovine infectionNatural infection dynamicsTemporal expression patternsHost-responsive dynamics

For each condition, both RNA-seq and quantitative RT-PCR should be employed to capture global transcriptional networks and validate specific lgt expression patterns.

3. Integrative Data Analysis Approaches:

  • Network Analysis: Construct gene co-expression networks to identify regulators that correlate with lgt expression

  • Regulatory Motif Discovery: Apply algorithms to identify overrepresented sequence motifs in promoters of co-regulated genes

  • Comparative Pathway Analysis: Map expression data onto metabolic and signaling pathways to identify functional connections

  • Machine Learning Classification: Train algorithms to predict lgt expression based on environmental and genetic variables

  • Multi-omics Integration: Correlate transcriptomic data with proteomic and metabolomic profiles when available

4. Functional Validation Strategies:

  • Reporter Fusion Constructs: Create lgt promoter-luciferase/GFP fusions to monitor expression in real-time

  • Targeted Mutagenesis: Use CRISPR-Cas9 to introduce mutations in predicted regulatory elements

  • Chromatin Immunoprecipitation (ChIP-seq): Identify transcription factors directly binding to the lgt promoter

  • CRISPR Interference: Use dCas9-based transcriptional repression to validate regulatory factors

5. Clinical and Epidemiological Correlation:

Recent studies have revealed concerning trends in S. Dublin infections, with a rise in multidrug resistance and invasive infections between 2011-2015 . Integrating expression data with clinical outcomes would allow researchers to:

  • Correlate lgt expression patterns with invasion capability

  • Link regulatory variations to antimicrobial resistance profiles

  • Identify expression biomarkers that predict virulence

  • Develop diagnostic tools based on specific expression signatures

Case Study Application:

The recently funded research collaboration between the University of Edinburgh and Quadram Institute (announced February 2025) provides an ideal framework for implementing this integrated approach . Their planned use of "cutting-edge genome sequencing and phenotyping techniques to investigate the genetic factors that contribute to the invasive nature of S. Dublin" could be expanded to include comprehensive transcriptomic profiling across infection conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.