Recombinant Salmonella dublin Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

General Information on CrcB Homologs

CrcB homologs are found in various bacteria and are often involved in carbon catabolite repression, a regulatory mechanism that prioritizes the use of preferred carbon sources over others . Although the precise function of CrcB in S. dublin may differ in some aspects from other bacteria, the core function is likely related to regulatory control.

Role in Virulence and Infection

Small proteins like MgrB have a role in Salmonella virulence . MgrB regulates the activity of the PhoPQ TCS, which is conserved in E. coli . A study showed that Δ mgrB Salmonella is impaired at all stages of macrophages and epithelial cells infection, relative to the isogenic wild-type strain . MgrB has a positive effect on flagella and motility-related genes at both the transcript and protein level and is linked to PhoPQ .

Regulatory Mechanisms Involving CrcB Homologs

The RcsCDB phosphorelay system controls a large regulon in Enterobacteriaceae, impacting biofilm formation, flagella production, synthesis of extracellular capsules, and cell division . The final effector of the RcsCDB system is the response regulator RcsB, which activates or represses multiple genes by binding to different promoter regions . RcsB can act alone or with other transcriptional factors, with its phosphorylation state influencing its activity .

Interactions with Other Proteins

RcsB interacts with proteins such as GadE, BglJ, MatA, or RflM . The auxiliary proteins TviA and RmpA have also been proposed to act in concert with RcsB .

Examples of Experimental Findings

ExperimentDetails
sopD mutants constructionAn internal DNA fragment of sopD was amplified by PCR with custom oligonucleotides and was cloned into the suicide plasmid vector pDM4 . The resulting plasmid was conjugated from Escherichia coli S17.1 into S. dublin 2229, and Cml r transconjugants were obtained .
MgrB contribution to Salmonella virulenceΔ mgrB Salmonella is impaired at all stages of macrophages and epithelial cells infection, relative to the isogenic wild-type strain . MgrB has a positive effect on flagella and motility-related genes at both the transcript and protein level and is linked to PhoPQ . In proteomics data, the histidine kinase SsrB was upregulated in the Δ mgrB mutant . Elevated SsrB levels are known to lead to a defect in epithelial cell invasion, another phenotype associated with the lack of MgrB .
RcsB regulation of genesRcsB regulates genes alone or in combination with auxiliary transcriptional factors independently or dependently of phosphorylation . Microarray analysis performed in Escherichia coli and Salmonella enterica serovar Typhimurium identified ∼100 genes comprising the Rcs regulon . Independently of phosphorylation, RcsB also regulates genes acting together with additional transcriptional factors such as GadE, BglJ, MatA, or RflM .
Hybrid plasmid detectionComparative analysis revealed the AUSMDU00035676 plasmid lacked the spv operon and had low homology to reference IncN and IncX1/IncFII(S) plasmids previously associated with Salmonella . This finding suggests the detection of a potentially novel hybrid plasmid with IncN/IncX1/IncFII(S) markers that encodes AMR and HMR determinants flanked by IS26 elements, which may aid gene mobilisation . In contrast, the AUSMDU00056868 plasmid had IncX1/IncFII(S) plasmid replicon markers and was found to not encode any mechanisms for resistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. Specify your preferred tag type in advance to prioritize its use in the manufacturing process.
Synonyms
crcB; SeD_A0731; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function

Crucial in reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella dublin Protein CrcB homolog (crcB)?

Recombinant Salmonella dublin Protein CrcB homolog (crcB) is a full-length protein (127 amino acids) derived from Salmonella dublin bacteria. It is classified as a putative fluoride ion transporter, with UniProt ID B5FMM5 . This protein is typically produced through recombinant expression in E. coli systems, often with an N-terminal His tag to facilitate purification and downstream experimental applications. The protein exists naturally in Salmonella dublin, a host-adapted serovar that has gained attention due to its increasing prevalence in dairy operations and its multidrug-resistant characteristics .

How should Recombinant Salmonella dublin Protein CrcB be stored for research purposes?

For optimal stability and activity retention, the following storage protocols are recommended:

Storage ConditionRecommendationPurpose
Short-term storage4°C for up to one weekWorking aliquots
Long-term storage-20°C/-80°CExtended preservation
Storage bufferTris-based buffer with 50% glycerol, pH 8.0Stability enhancement
Important precautionsAvoid repeated freeze-thaw cyclesPrevent protein degradation

The recommended reconstitution procedure involves:

  • Brief centrifugation of the vial before opening

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% for long-term storage

What is the role of CrcB in Salmonella pathogenicity and virulence?

While the specific role of CrcB in Salmonella dublin virulence isn't directly established in the provided literature, its function should be considered within the broader context of Salmonella dublin's virulence mechanisms. Salmonella dublin expresses numerous virulence factors that contribute to its invasive capacity, including:

  • Type III Secretion Systems encoded by Salmonella Pathogenicity Islands (SPI-1 and SPI-2), which facilitate intestinal invasion and systemic spread

  • Type VI Secretion Systems from SPI-6 and SPI-19, which enable injection of effector proteins into host cells

  • The pSDV plasmid with spv operon associated with host cellular apoptosis

  • Flagella encoded by the gene fliC that enable motility and chemotaxis responses

  • Multiple fimbriae that aid in adhesion to host cells

As a putative fluoride ion transporter, CrcB may contribute to ion homeostasis and potentially play a role in environmental adaptation during infection processes. Research into its specific contribution to virulence would require gene knockout studies and subsequent virulence assessment in appropriate model systems.

How does CrcB contribute to antimicrobial resistance in Salmonella dublin?

The relationship between CrcB and antimicrobial resistance in Salmonella dublin represents an important research frontier. Salmonella dublin has emerged as one of the most multidrug-resistant serotypes in the United States, with resistance documented against multiple antimicrobial classes .

Antimicrobial resistance in Salmonella develops through different mechanisms depending on the drug:

  • Fluoroquinolone resistance typically occurs through chromosomal mutations and clonal dissemination

  • Cephalosporin resistance usually develops through acquisition of mobile genetic elements via plasmids and transposons

The National Antimicrobial Resistance Monitoring System (NARMS) reported that among S. Dublin isolates:

  • 84% were resistant to five or more classes of antimicrobial drugs

  • 57% were resistant to seven or more antimicrobial classes

  • There was an increase from 29% to 79% in isolates resistant to one or more antimicrobial classes when comparing 1996-2004 with 2005-2013

Studies have documented S. Dublin resistance to multiple antibiotics including:

  • Ampicillin

  • Chloramphenicol

  • Neomycin

  • Tetracycline

  • Streptomycin

  • Sulfonamide

  • Amoxicillin/clavulanic acid

  • Ceftriaxone

While the direct contribution of CrcB to this resistance profile has not been specifically delineated in the provided sources, its potential role in ion transport could influence bacterial membrane permeability and possibly affect drug uptake or efflux. Research investigating CrcB knockout strains and their antimicrobial susceptibility profiles would provide valuable insights into whether this protein contributes to the multidrug resistance phenotype.

What experimental approaches are recommended for studying CrcB function?

To systematically investigate CrcB function in Salmonella dublin, researchers should consider the following methodological approaches:

  • Gene Expression Analysis

    • qRT-PCR to quantify crcB expression under different environmental conditions

    • RNA-seq to identify co-regulated genes in the CrcB regulon

    • Reporter gene assays to monitor promoter activity

  • Protein Localization and Interaction Studies

    • Fluorescent protein tagging for subcellular localization

    • Immunoprecipitation coupled with mass spectrometry to identify protein-protein interactions

    • Bacterial two-hybrid systems to validate specific interactions

    • Membrane fractionation to confirm membrane association

  • Functional Characterization

    • Gene deletion and complementation studies

    • Site-directed mutagenesis of conserved residues

    • Fluoride sensitivity assays (given its putative role as a fluoride transporter)

    • Ion flux measurements using fluorescent indicators or radioisotopes

    • Electrophysiological studies in reconstituted membrane systems

  • Structural Analysis

    • X-ray crystallography or cryo-EM for high-resolution structural determination

    • Circular dichroism for secondary structure analysis

    • Limited proteolysis to identify domain boundaries

How does Salmonella dublin CrcB compare with homologs in other bacterial species?

Comparative analysis of CrcB homologs across bacterial species provides valuable evolutionary and functional insights. The CrcB protein belongs to a conserved family of membrane proteins found in many bacterial species, with primary function typically associated with fluoride ion transport.

Key comparative aspects include:

CharacteristicSalmonella dublin CrcBCrcB in Other Species
Sequence length127 amino acidsTypically 120-130 amino acids
Membrane topologyMultiple transmembrane domainsGenerally conserved topology
ConservationHigh sequence similarity within EnterobacteriaceaeModerately conserved across bacterial phyla
FunctionPutative fluoride ion transporterConfirmed fluoride ion channel in some species
Association with virulenceUnder investigationVariable, species-dependent

Homology modeling using better-characterized CrcB proteins as templates could provide structural insights into the Salmonella dublin protein. Additionally, complementation studies in heterologous systems could determine functional conservation across species.

What are the optimal conditions for recombinant expression and purification of CrcB?

Based on the available information, the following protocol represents current best practices for recombinant CrcB expression and purification:

Expression System:

  • Host: E. coli (strain optimization may be required)

  • Vector: Expression vector with N-terminal His-tag

  • Induction: IPTG-inducible promoter system (optimization of concentration and temperature recommended)

Purification Protocol:

  • Cell lysis via sonication or French press in appropriate buffer

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using mild detergents (e.g., DDM, LDAO)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification

  • Final product stored in Tris-based buffer with 50% glycerol at pH 8.0

Protein Quality Assessment:

  • Purity confirmation via SDS-PAGE (>90% purity is typically achieved)

  • Western blot analysis with anti-His antibodies

  • Activity assays (e.g., fluoride transport assays)

  • Circular dichroism to confirm proper folding

How can CrcB be utilized in antimicrobial resistance research?

Given the increasing prevalence of multidrug-resistant Salmonella Dublin strains, CrcB represents a potential target for antimicrobial research strategies. Researchers could explore:

  • CrcB as a Drug Target:

    • Development of specific inhibitors targeting CrcB function

    • Screening of compound libraries against purified CrcB

    • Structure-based drug design once crystal structure is determined

  • Role in Resistance Mechanisms:

    • Investigation of CrcB expression levels in resistant vs. susceptible strains

    • Analysis of genetic variations in crcB gene across resistant isolates

    • Determination of whether CrcB influences uptake or efflux of antimicrobial compounds

  • Combination Therapies:

    • Assessment of synergistic effects between CrcB inhibitors and conventional antibiotics

    • Evaluation of ion transport inhibitors as resistance modifiers

The multi-drug resistance profile of Salmonella Dublin to critical antibiotics (including ampicillin, chloramphenicol, tetracycline, and ceftriaxone) makes this research particularly urgent from a public health perspective .

What methods are effective for studying CrcB's role in Salmonella Dublin virulence?

To elucidate CrcB's contribution to Salmonella Dublin's distinctive virulence profile, researchers should consider:

  • Animal Models:

    • Bovine infection models (given S. Dublin's host adaptation)

    • Mouse models for preliminary screening

    • Cell culture systems using bovine intestinal and macrophage cell lines

  • Virulence Assays:

    • Invasion assays in epithelial cell lines

    • Intracellular survival in macrophages

    • Biofilm formation assays

    • Competitive index experiments with wildtype and crcB mutants

  • Transcriptomic Approaches:

    • RNA-seq analysis of host response to wildtype vs. crcB mutants

    • Identification of virulence factors co-regulated with crcB

Salmonella Dublin's clinical manifestation is more severe than other Salmonella serovars due to its enhanced invasive capacity in cattle . Understanding CrcB's contribution to this characteristic could provide valuable insights for intervention strategies.

What are common challenges in working with recombinant CrcB and how can they be addressed?

Researchers working with recombinant CrcB often encounter several technical challenges:

ChallengePotential Solution
Low expression levelsOptimize codon usage for expression host; test different promoter systems; evaluate different E. coli strains
Protein insolubilityExpress as fusion protein with solubility enhancers; optimize lysis and extraction buffers; use mild detergents for membrane protein extraction
Protein instabilityAdd stabilizing agents to buffer; optimize pH and ionic strength; maintain consistent cold chain
Loss of activity during purificationMinimize purification steps; confirm activity at each purification stage; identify stabilizing conditions
AggregationInclude low concentrations of appropriate detergents; optimize protein concentration; include reducing agents if appropriate

When troubleshooting purification issues, researchers should consider implementing a systematic approach testing different buffer compositions, detergents, and stabilizing agents to identify optimal conditions for maintaining CrcB structural integrity and function.

How can researchers validate the functional activity of purified recombinant CrcB?

Functional validation of purified CrcB is essential before proceeding with downstream applications. Recommended validation approaches include:

  • Transport Activity Assays:

    • Fluoride ion transport assays using fluorescent indicators

    • Liposome reconstitution assays to measure ion flux

    • Patch-clamp electrophysiology on reconstituted channels

  • Binding Assays:

    • Fluoride binding assays using isothermal titration calorimetry

    • Fluorescence-based ligand binding assays

    • Surface plasmon resonance with potential interacting partners

  • Structural Integrity Assessment:

    • Circular dichroism to confirm secondary structure

    • Size exclusion chromatography to verify oligomeric state

    • Thermal shift assays to assess stability

These complementary approaches provide a comprehensive assessment of CrcB functionality, ensuring that the recombinant protein maintains native-like properties suitable for further experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.