Recombinant Salmonella dublin Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

GlpG hydrolyzes peptide bonds within transmembrane substrates using a Ser-201–His-254 dyad . Key findings:

  • Inhibitor Studies: Diisopropyl fluorophosphonate (DFP) and isocoumarin derivatives (e.g., JLK-6) irreversibly inhibit GlpG by covalently binding to Ser-201 .

  • Substrate Recognition: Prefers substrates with hydrophilic residues near transmembrane domains, as shown using engineered E. coli model proteins .

Role in Bacterial Physiology

  • Metabolic Regulation: GlpG influences fatty acid β-oxidation and glycerol metabolism in E. coli, enhancing bacterial fitness in nutrient-limited environments like the mammalian gut .

  • Pathogenicity: In Salmonella, GlpG may indirectly affect virulence by modulating membrane protein turnover, though direct substrates remain unidentified .

Production and Purification Protocols

Recombinant GlpG is typically produced under optimized conditions:

ParameterSpecification
Induction0.2–1.0 mM IPTG, 18–37°C
Yield1–2.5 mg/L culture
PurificationImmobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC)
StorageTris buffer with 50% glycerol; stable at -20°C or -80°C

Drug Discovery

  • Inhibitor Screening: Saccharin-based compounds (e.g., Bsc5195) and β-lactams target GlpG’s active site, serving as leads for antimicrobial development .

  • Enzyme Kinetics: Fluorogenic substrates (e.g., KSp76) enable real-time activity assays .

Vaccine Development

Recombinant GlpG is utilized in Salmonella vaccine research due to its antigenic potential, though no clinical candidates have been reported .

Comparative Analysis of Recombinant GlpG Variants

Data from MyBioSource highlights GlpG homologs across bacterial species:

SpeciesGene LocusHost SystemPurity
Salmonella dublinSeD_A3894 (glpG)E. coli/yeast/baculovirus/mammalian cells≥85%
E. coli O9:H4EcHS_A3621 (glpG)E. coli/yeast/baculovirus/mammalian cells≥85%
Shigella boydiiSbBS512_E3806E. coli/yeast/baculovirus/mammalian cells≥85%

Challenges and Future Directions

  • Substrate Identification: Natural substrates of GlpG in Salmonella remain unknown, limiting mechanistic studies .

  • Inhibitor Specificity: Current inhibitors lack selectivity between bacterial and eukaryotic rhomboids .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
glpG; SeD_A3894; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella dublin Rhomboid protease GlpG?

Recombinant Salmonella dublin Rhomboid protease GlpG (glpG) is a full-length membrane protein (spanning amino acids 1-276) that functions as an intramembrane serine protease. The recombinant form is typically expressed in E. coli with an N-terminal His tag to facilitate purification. This protein (UniProt ID: B5FKE3) belongs to a family of membrane-integrated enzymes that hydrolyze peptide bonds within the transmembrane domains of other proteins . The enzyme is structurally characterized by a catalytic dyad (Ser201-His254) and an oxyanion hole (His150/Asn154/the backbone amide of Ser201), which are essential for its proteolytic activity .

What is the amino acid sequence of Salmonella dublin GlpG and its key features?

The full amino acid sequence of Salmonella dublin GlpG is:
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPGDPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVMVWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAGWFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT

Key structural features include:

  • Catalytic dyad: Ser201-His254

  • Oxyanion hole: His150/Asn154/the backbone amide of Ser201

  • Multiple transmembrane domains that position the active site within the lipid bilayer

  • Modular functional architecture that influences its folding pathways

How should recombinant GlpG be stored and reconstituted for experimental use?

For optimal preservation of recombinant GlpG activity, the following storage and reconstitution protocols are recommended:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term storageAdd 5-50% glycerol (recommended final: 50%) and aliquot
Working aliquotsStore at 4°C for up to one week
Freeze-thawAvoid repeated freeze-thaw cycles

Prior to opening, briefly centrifuge the vial to bring contents to the bottom. For experimental work, aliquot the reconstituted protein to minimize freeze-thaw cycles that can decrease activity .

What expression systems are used for producing recombinant Salmonella dublin GlpG?

E. coli is the predominant expression system for recombinant Salmonella dublin GlpG production. The methodology typically involves:

  • Cloning the full-length glpG gene (amino acids 1-276) into an expression vector

  • Adding an N-terminal His tag for affinity purification

  • Transforming E. coli cells with the expression construct

  • Inducing protein expression with appropriate inducers

  • Lysing cells and solubilizing membrane fractions with detergents

  • Purifying the protein via affinity chromatography using the His tag

  • Final purification steps to achieve >90% purity as determined by SDS-PAGE

This expression system produces properly folded GlpG suitable for biochemical and structural studies, though researchers should be aware that the detergent environment differs from the native lipid bilayer context .

How does the folding mechanism of GlpG differ in lipid bilayers versus detergent micelles?

The folding mechanism of GlpG exhibits significant differences between lipid bilayers and detergent micelles, which has important implications for experimental design and interpretation:

In lipid bilayers:

  • GlpG folds via sequential insertion of helical hairpins

  • The bilayer provides topological constraints that guide the folding process

  • Backtracking (local unfolding of previously folded substructures) is minimized

  • The folding pathway is more direct and efficient, reflecting the environment in which GlpG has evolved to fold

In detergent micelles:

  • Multiple folding pathways exist due to GlpG's modular architecture

  • Significant backtracking occurs during folding

  • Large entropic costs are associated with organizing helical bundles without bilayer constraints

  • Thermodynamically destabilizing mutations can paradoxically accelerate folding in this environment

These differences highlight why researchers should carefully consider the membrane mimetic environment when studying GlpG folding and function. Simulation data suggests that GlpG's energy landscape is fundamentally altered by the presence or absence of a constraining bilayer, with the rate-limiting step involving simultaneous insertion and folding of the final helical hairpin in bilayer environments .

What is the significance of weak interaction energies in GlpG's active site?

The active site of GlpG features unusually weak hydrogen bonding interactions that have significant implications for its catalytic mechanism:

  • Interaction energies measured by double mutant cycle analysis in mild detergent reveal:

    • Between His254 and Ser201: ΔΔGInter of -1.4 kcal/mol

    • Between Ser201 and Asn154: ΔΔGInter of -0.2 kcal/mol

  • These weak interactions may explain several unique features of GlpG:

    • Unusually slow proteolysis compared to canonical serine proteases

    • Reduced risk of indiscriminate cleavage of membrane proteins (catalytic efficiency k𝑐𝑎𝑡 ≈ 0.006/s)

    • Controlled quality control function that selectively targets orphan membrane proteins without disrupting functional complexes

  • Despite their weakness, these hydrogen bonds are sufficient to carry out the proteolytic function, suggesting an evolutionary balance between activity and specificity

This finding challenges the traditional understanding of serine proteases, which typically feature strong hydrogen bonding networks at their active sites, and provides insight into how GlpG functions in the membrane environment where water is scarce .

How does GlpG contribute to membrane protein quality control?

GlpG plays a critical role in membrane protein quality control through the following mechanisms:

  • Substrate specificity:

    • Selectively targets orphan components of respiratory complexes

    • Recognizes metastable transmembrane domains (TMDs) that are exposed when not incorporated into functional complexes

    • Does not cleave the same TMDs when they are protected within assembled complexes

  • Quality control mechanism:

    • Initial cleavage by GlpG creates fragments that are subsequently degraded

    • This prevents accumulation of potentially toxic orphan membrane proteins

    • The system specifically protects functional complexes from degradation

  • Research methodology to study this function:

    • Use of genetic knockouts of GlpG to analyze accumulation of orphan subunits

    • Membrane fractionation and proteomic analysis to identify substrates

    • Activity assays to confirm that GlpG has no effect on functional complex activity (e.g., Hyd-2 activity remains unaffected under normal growth conditions)

This quality control function appears to be evolutionarily conserved, suggesting similar mechanisms may operate in eukaryotic systems to protect cells from the damaging effects of orphan membrane proteins .

What experimental approaches can elucidate the energy landscape of GlpG folding?

The energy landscape of GlpG folding can be investigated using several complementary experimental and computational approaches:

  • Force spectroscopy:

    • Measures the kinetic stability of the folded state

    • Quantifies thermodynamic stability

    • Reveals high kinetic stability despite relatively low thermodynamic stability

  • Structural free-energy landscape analysis:

    • Computational simulation of spontaneous insertion and folding

    • Identifies sequential insertion of helical hairpins

    • Determines rate-limiting steps in the folding process

    • Reveals the presence of partially inserted metastable states

  • Steric trapping combined with double mutant cycle analysis:

    • Measures interaction energies between active site residues

    • Assesses the impact of mutations on folding cooperativity

    • Quantifies the propagation effects of single mutations throughout the protein structure

  • Comparison of folding in different membrane mimetics:

    • Contrasts folding in detergent micelles versus lipid bilayers

    • Identifies environment-specific folding pathways

    • Reveals the influence of topological constraints on folding efficiency

These approaches have collectively revealed that GlpG's modular functional architecture leads to multiple possible folding pathways and the population of near-native states with functional significance .

How can mutations in GlpG be designed to study its folding mechanism?

Designing mutations to study GlpG's folding mechanism requires careful consideration of several factors:

  • Strategic mutation selection:

    • Target residues in the catalytic dyad (Ser201, His254) and oxyanion hole (His150, Asn154)

    • Modify residues at the interfaces between folding modules

    • Introduce mutations that alter the stability of specific helical hairpins

  • Paradoxical effects of destabilizing mutations:

    • Thermodynamically destabilizing mutations can accelerate folding in detergent micelles

    • This occurs by reducing backtracking during the folding process

    • Such mutations help identify folding bottlenecks and intermediate states

  • Experimental analysis of mutant effects:

    • Measure changes in folding rates through kinetic assays

    • Assess thermodynamic stability changes using steric trapping

    • Evaluate functional impacts through activity assays

    • Analyze propagation effects throughout the protein structure

  • Interpretation considerations:

    • Mutations may have different effects in bilayers versus detergent micelles

    • Changes in folding cooperativity can reveal interdependence of structural elements

    • Weak coupling between active site residues suggests distributed stabilization throughout the structure

This approach has yielded valuable insights, such as the finding that active site residues contribute not only to function but also to the folding cooperativity of GlpG .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.