Recombinant Salmonella dublin Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While tag type is determined during production, we prioritize fulfilling requests for specified tags. Please communicate your tag requirements to us.
Synonyms
mdtI; SeD_A1857; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its function in Salmonella Dublin?

MdtI is a component of the MdtJI protein complex that functions as a spermidine excretion system in Salmonella. The MdtI protein belongs to the small multidrug resistance (SMR) family of drug exporters and works in conjunction with MdtJ to form a functional complex that catalyzes the excretion of spermidine from bacterial cells. Research has demonstrated that both mdtJ and mdtI genes are necessary for protection against the toxicity that results from spermidine overaccumulation within the cell. The complex helps maintain appropriate intracellular polyamine levels, which is critical for bacterial growth and survival .

How does the MdtJI complex contribute to spermidine homeostasis?

The MdtJI complex plays a crucial role in spermidine homeostasis by actively exporting excess spermidine from the bacterial cell. Studies have shown that bacteria expressing functional MdtJI proteins demonstrate decreased intracellular spermidine content when cultured in media containing high spermidine concentrations (2 mM). Additionally, research has confirmed that the MdtJI complex enhances spermidine excretion from cells, reducing potential cytotoxic effects of polyamine accumulation. The expression of mdtJI mRNA is upregulated in response to elevated spermidine levels, suggesting a regulatory feedback mechanism that helps maintain polyamine homeostasis .

What are the key amino acid residues critical for MdtI function?

Experimental studies have identified several specific amino acid residues in MdtI that are essential for its spermidine export activity. These include:

  • Glu5 (glutamic acid at position 5)

  • Glu19 (glutamic acid at position 19)

  • Asp60 (aspartic acid at position 60)

  • Trp68 (tryptophan at position 68)

  • Trp81 (tryptophan at position 81)

These residues likely contribute to substrate recognition, protein folding, or formation of the transport channel within the MdtJI complex. Mutation of these critical residues results in diminished spermidine export activity, confirming their functional importance .

What experimental approaches are optimal for generating and characterizing recombinant MdtI from Salmonella Dublin?

For efficient production and characterization of recombinant S. Dublin MdtI, researchers should consider the following methodological approach:

  • Gene Cloning and Expression System Selection:

    • PCR amplification of the mdtI gene from S. Dublin genomic DNA

    • Cloning into an expression vector with an inducible promoter (e.g., pET system)

    • Introduction of affinity tags (His6 or FLAG) to facilitate purification

    • Expression in E. coli strains optimized for membrane protein production (e.g., C41(DE3) or C43(DE3))

  • Protein Purification Strategy:

    • Membrane isolation by differential centrifugation

    • Solubilization with appropriate detergents (e.g., DDM, LDAO)

    • Affinity chromatography followed by size exclusion chromatography

    • Quality assessment by SDS-PAGE and Western blotting

  • Functional Characterization:

    • Reconstitution into proteoliposomes for transport assays

    • Spermidine uptake/efflux measurements using radiolabeled substrates

    • Site-directed mutagenesis of key residues (Glu5, Glu19, Asp60, Trp68, Trp81) followed by functional assessment

This comprehensive approach enables isolation of pure, functional MdtI protein for detailed biochemical and structural studies, facilitating comparisons with homologous proteins like those characterized in E. coli .

What is the potential role of MdtI in Salmonella Dublin pathogenicity and host adaptation?

The potential contribution of MdtI to S. Dublin pathogenicity and host adaptation involves several interconnected mechanisms:

  • Polyamine Homeostasis and Stress Response:

    • MdtI's role in spermidine export likely contributes to bacterial adaptation to varying host environments

    • Proper polyamine levels are essential for bacterial responses to oxidative stress, which occurs during host immune responses

    • Regulation of intracellular polyamine concentrations may influence expression of virulence genes

  • Relationship to Host-Adaptation:

    • S. Dublin is primarily host-adapted to cattle, causing both systemic and enteric disease

    • Polyamine metabolism differs between host species, potentially requiring specialized export systems

    • The MdtJI system may contribute to S. Dublin's ability to persist in carrier animals, leading to sporadic disease outbreaks

  • Interaction with Pathogenicity Islands:

    • S. Dublin virulence depends on Salmonella Pathogenicity Islands (SPI)

    • SPI-2 is essential for both systemic and enteric salmonellosis in calves

    • Potential regulatory crosstalk between polyamine homeostasis systems and pathogenicity island expression remains to be investigated

To fully elucidate MdtI's role in pathogenicity, researchers should consider generating mdtI deletion mutants and evaluating their virulence in cellular and animal models, with particular attention to differences in systemic spread and persistence .

How can we effectively design experiments to study the impact of antimicrobial exposure on MdtI expression and function?

To investigate how antimicrobial exposure affects MdtI expression and function, researchers should implement a comprehensive experimental design:

  • Transcriptional Analysis:

    • qRT-PCR to measure mdtI expression changes following exposure to various antimicrobial agents

    • RNA-Seq to capture global transcriptional responses and identify potential regulatory networks

    • Reporter gene fusions (mdtI promoter-GFP) to monitor real-time expression changes

  • Protein Level Assessment:

    • Western blotting with MdtI-specific antibodies to quantify protein levels

    • Membrane proteomics to measure changes in MdtI abundance relative to other membrane proteins

    • Fluorescently-tagged MdtI to track subcellular localization under antimicrobial stress

  • Functional Studies:

    • Spermidine transport assays in the presence of subinhibitory antimicrobial concentrations

    • Comparative survival assays between wild-type and mdtI mutant strains under antimicrobial pressure

    • Competition assays to evaluate fitness costs/benefits of MdtI expression

  • Clinical Isolate Analysis:

    • Correlation analysis between mdtI sequence variations/expression levels and antimicrobial resistance profiles

    • Comparison of MdtI activity in multidrug-resistant versus susceptible S. Dublin isolates

This approach would clarify whether antimicrobial exposure induces changes in MdtI expression as part of a broader stress response and whether such changes contribute to reduced antimicrobial susceptibility in S. Dublin .

What techniques can be used to investigate interactions between MdtI and other components of multidrug resistance systems in Salmonella Dublin?

Investigating interactions between MdtI and other MDR components requires sophisticated molecular and biochemical approaches:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation (Co-IP) with MdtI-specific antibodies

    • Bacterial two-hybrid (B2H) screening to identify novel interaction partners

    • Proximity-dependent biotin identification (BioID) to capture transient interactions

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

  • Genetic Interaction Mapping:

    • Construction of double/triple mutants combining mdtI deletion with other MDR gene knockouts

    • Synthetic genetic array (SGA) analysis to identify genetic interactions systematically

    • CRISPR interference screens targeting multiple MDR components simultaneously

  • Structural Biology Approaches:

    • Cryo-electron microscopy to visualize MdtI in complex with other membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map binding interfaces

    • Molecular dynamics simulations to predict functional interactions

  • Functional Genomics Integration:

    • Correlation analysis between expression patterns of mdtI and other resistance genes

    • Network analysis of transcriptomic data from antimicrobial-exposed S. Dublin

    • Integration of plasmid profile data with MdtI expression/function studies

This multi-faceted approach would help determine whether MdtI functions independently or as part of larger resistance complexes, which is particularly relevant given the high prevalence of plasmid-borne resistance determinants in S. Dublin (including IncA/C2, IncX1, and IncFII(S) plasmids) .

What are the optimal protocols for assessing spermidine export activity in recombinant MdtI systems?

For robust assessment of spermidine export activity in recombinant MdtI systems, researchers should consider the following optimized protocols:

  • Whole-Cell Export Assays:

    • Culture bacteria expressing recombinant MdtI in media supplemented with radiolabeled spermidine (e.g., [14C]-spermidine)

    • Following incubation, separate cells from media by rapid filtration

    • Quantify extracellular (exported) and intracellular spermidine by liquid scintillation counting

    • Include appropriate controls: vector-only, inactive MdtI mutants, and known spermidine transport inhibitors

  • Proteoliposome-Based Transport Assays:

    • Purify recombinant MdtI and reconstitute into proteoliposomes

    • Preload liposomes with spermidine or create a spermidine gradient

    • Monitor spermidine efflux/transport using fluorescent spermidine analogs or radiolabeled substrates

    • Assess transport kinetics under varying conditions (pH, temperature, ion gradients)

  • Cellular Toxicity Recovery Assays:

    • Express recombinant MdtI in spermidine-sensitive strains (e.g., spermidine acetyltransferase-deficient E. coli)

    • Challenge cells with toxic spermidine concentrations

    • Measure growth recovery as an indirect measure of export function

    • Compare wild-type MdtI with site-directed mutants of key residues (Glu5, Glu19, Asp60, Trp68, Trp81)

These methods, particularly when used in combination, provide complementary data on both the in vivo function and the biochemical characteristics of the recombinant MdtI protein, enabling detailed structure-function analyses similar to those performed for the E. coli homolog .

How can researchers effectively study the regulation of mdtI gene expression in response to environmental stressors?

To comprehensively investigate mdtI regulation in response to environmental stressors, researchers should implement the following methodological approaches:

  • Promoter Mapping and Analysis:

    • 5' RACE to identify transcription start sites

    • Promoter deletion analysis using reporter gene fusions

    • DNase I footprinting to identify protein-binding regions

    • ChIP-seq to identify transcription factors binding to the mdtI promoter in vivo

  • Stress Response Studies:

    • Expose S. Dublin cultures to various stressors (oxidative stress, pH changes, antimicrobials)

    • Quantify mdtI transcript levels using qRT-PCR or RNA-Seq

    • Monitor protein levels using Western blotting or targeted proteomics

    • Construct a panel of stress-responsive transcription factor mutants to identify regulators

  • Multi-omics Integration:

    • Correlate transcriptomic changes with metabolomic profiles

    • Focus on polyamine metabolism intermediates

    • Perform network analysis to identify regulatory hubs

    • Develop computational models of mdtI regulation

  • In vivo Regulation Studies:

    • Use animal infection models to assess mdtI expression during different stages of infection

    • Compare expression in different host tissues and under immune pressure

    • Develop fluorescent reporters for real-time monitoring of expression in infection models

This comprehensive approach would reveal how environmental conditions encountered during infection influence mdtI expression and potentially contribute to S. Dublin's host adaptation and pathogenicity .

What bioinformatic approaches are most effective for analyzing evolutionary conservation of MdtI across Salmonella serovars?

For robust evolutionary analysis of MdtI across Salmonella serovars, researchers should employ a multilayered bioinformatic approach:

  • Sequence Collection and Alignment:

    • Extract mdtI gene and protein sequences from available Salmonella genomes

    • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Identify core conserved regions and variable domains

    • Calculate conservation scores for each amino acid position

  • Phylogenetic Analysis:

    • Construct maximum likelihood or Bayesian phylogenetic trees

    • Compare mdtI-based trees with whole-genome phylogenies

    • Assess congruence to identify potential horizontal gene transfer events

    • Apply selection pressure analysis (dN/dS ratios) to identify positions under purifying or positive selection

  • Structural Prediction and Conservation Mapping:

    • Generate homology models of MdtI from different Salmonella serovars

    • Map conservation scores onto 3D structures

    • Identify conservation patterns in functional domains (e.g., transmembrane regions, binding sites)

    • Perform molecular dynamics simulations to assess functional implications of sequence variations

  • Comparative Genomic Context Analysis:

    • Examine conservation of genomic neighborhoods around mdtI

    • Identify potential operon structures and co-regulated genes

    • Assess presence of mobile genetic elements or recombination hotspots

    • Compare with closely related species (e.g., E. coli) to identify serovar-specific features

This comprehensive approach would provide insights into how MdtI has evolved across Salmonella serovars, potentially revealing adaptation-related sequence variations in host-adapted serovars like S. Dublin compared to broader-host-range serovars .

How might understanding MdtI function contribute to novel antimicrobial development strategies?

Understanding MdtI function could inform antimicrobial development through several potential strategies:

  • Direct Inhibition of Spermidine Export:

    • Developing specific MdtI inhibitors could disrupt polyamine homeostasis

    • Excess intracellular spermidine accumulation would lead to toxicity

    • Such inhibitors could act synergistically with existing antimicrobials

    • Structure-based drug design targeting key residues (Glu5, Glu19, Asp60, Trp68, Trp81) could yield specific inhibitors

  • Targeting Host-Adaptation Mechanisms:

    • If MdtI contributes to S. Dublin's host adaptation in cattle, inhibitors might reduce persistence

    • This could help prevent carrier states that lead to recurrent infections

    • Such approaches might reduce the reservoir of S. Dublin in cattle populations

  • Combination Therapies Exploiting MDR Systems:

    • Understanding interactions between MdtI and other MDR components

    • Developing inhibitors that simultaneously target multiple export systems

    • Potential to overcome established resistance mechanisms in highly resistant S. Dublin strains (98% of isolates resistant to >4 antimicrobials)

  • Vaccine Development Considerations:

    • MdtI's role in pathogenicity may inform attenuated vaccine development

    • Mutations affecting export function could create strains with reduced virulence

    • Such strains might retain immunogenicity while showing impaired in vivo persistence

These strategies require further investigation of MdtI's precise role in S. Dublin pathophysiology, but they represent promising avenues for addressing the significant public health concerns posed by this increasingly antimicrobial-resistant pathogen .

What are the most promising methodologies for investigating the interplay between MdtI function and Salmonella Dublin virulence in vivo?

To elucidate the relationship between MdtI function and S. Dublin virulence in vivo, researchers should consider these methodological approaches:

  • Genetically Modified Strains for Animal Models:

    • Generate precise mdtI deletion mutants using CRISPR-Cas9

    • Create complemented strains with wild-type and site-directed mutants

    • Develop inducible expression systems to modulate MdtI levels during infection

    • Engineer fluorescently tagged strains for in vivo tracking

  • Multi-host Infection Models:

    • Compare virulence in natural hosts (calves) and alternate hosts (mice)

    • Assess tissue distribution, bacterial loads, and persistence

    • Evaluate host-specific differences in pathology and immune responses

    • Use signature-tagged mutagenesis to assess competitive fitness in mixed infections

  • Ex Vivo Tissue Models:

    • Bovine intestinal epithelial organoids or explants

    • Precision-cut lung slices for respiratory infection modeling

    • Primary bovine macrophage infection assays

    • Measurement of intracellular survival and replication

  • Host Response Analysis:

    • Comparative transcriptomics of host tissues infected with wild-type versus mdtI mutants

    • Immune profiling (cytokines, cellular responses)

    • Metabolomic analysis focusing on polyamine pathway alterations

    • Histopathological assessment of tissue damage and inflammation

These approaches would provide a comprehensive understanding of how MdtI contributes to S. Dublin's capacity to cause both enteric and systemic disease in cattle, with potential implications for human infections. The comparative animal model approach is particularly valuable, given that S. Dublin has shown different virulence characteristics in different host species .

How can systems biology approaches integrate MdtI function into broader models of Salmonella Dublin pathogenicity?

Systems biology offers powerful frameworks to contextualize MdtI within S. Dublin's complex pathogenicity networks:

  • Multi-omics Data Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Focus on conditions relevant to infection (e.g., macrophage internalization)

    • Identify regulatory networks connecting MdtI with virulence determinants

    • Construct comprehensive pathway maps integrating polyamine metabolism with virulence

  • Network Analysis and Modeling:

    • Generate protein-protein interaction networks centered on MdtI

    • Identify hub proteins connecting MdtI to virulence systems

    • Develop mathematical models predicting system behavior upon perturbation

    • Simulate effects of antimicrobial exposure on network dynamics

  • Comparative Systems Analysis:

    • Compare S. Dublin networks with other Salmonella serovars

    • Identify host-adaptation specific features

    • Contrast virulent versus attenuated strains to identify critical nodes

    • Evaluate network conservation across different bacterial pathogens with MdtI homologs

  • Integration with Host Response Data:

    • Model bacterial-host interactions at systems level

    • Identify critical points where bacterial MdtI function influences host response

    • Predict therapeutic targets with minimal collateral effects

    • Develop host-pathogen interaction maps specific to bovine infections

This systems-level understanding would place MdtI in proper context within S. Dublin's virulence arsenal, potentially revealing unexpected connections between polyamine homeostasis, antimicrobial resistance, and pathogenicity factors encoded by SPIs. Such comprehensive models would guide more targeted experimental approaches and potentially reveal novel intervention strategies against this host-adapted pathogen .

What are the major challenges in expressing and purifying functional recombinant MdtI protein?

Expressing and purifying functional membrane proteins like MdtI presents several technical challenges that can be addressed through specialized approaches:

  • Expression Challenges and Solutions:

ChallengeSolutionRationale
Toxicity to expression hostUse tightly regulated expression systems (e.g., pBAD)Prevents leaky expression that may impair host growth
Membrane protein overexpressionUtilize specialized E. coli strains (C41(DE3), C43(DE3))These strains are adapted for membrane protein expression
Improper foldingCo-express with chaperonesEnhances correct folding of complex membrane proteins
Low expression levelsOptimize codon usage for expression hostImproves translation efficiency
Formation of inclusion bodiesLower induction temperature (16-20°C)Slows protein synthesis, allowing proper membrane insertion
  • Purification Challenges and Solutions:

ChallengeSolutionRationale
Detergent selectionScreen multiple detergents (DDM, LDAO, LMNG)Different proteins require specific detergents for stability
Maintaining protein-protein interactionsUse mild solubilization conditionsPreserves native MdtI-MdtJ complex
Low yieldScale-up approaches and optimized extractionCompensates for typically low membrane protein yields
Aggregation during concentrationAdd glycerol or specific lipidsStabilizes protein structure during concentration
Assessing functional integrityDevelop activity assays applicable to purified proteinConfirms that purification preserved function
  • Validation Approaches:

    • Circular dichroism to confirm secondary structure integrity

    • Size-exclusion chromatography to assess oligomeric state

    • Functional reconstitution into proteoliposomes

    • Thermal stability assays with varying buffer conditions

These methodological considerations are essential for obtaining sufficient quantities of functional MdtI protein for structural and biochemical studies, which are crucial for understanding its role in spermidine export and potential contributions to S. Dublin pathophysiology .

How can researchers effectively address the complexity of studying MdtI in the context of its native MdtJI complex?

Studying MdtI within its native MdtJI complex presents unique challenges requiring specialized approaches:

  • Co-Expression Strategies:

    • Design bicistronic constructs maintaining native gene organization

    • Employ dual-affinity tags (e.g., His-tag on MdtI, FLAG-tag on MdtJ)

    • Utilize tandem affinity purification to isolate intact complexes

    • Screen various expression conditions to optimize complex formation

  • Interaction Analysis Techniques:

    • Native PAGE to preserve non-covalent interactions

    • Crosslinking mass spectrometry to map interaction interfaces

    • Fluorescence resonance energy transfer (FRET) to confirm association

    • Analytical ultracentrifugation to determine stoichiometry

  • Functional Reconstitution Approaches:

    • Co-reconstitution of purified MdtI and MdtJ into liposomes

    • Compare activities of individual proteins versus the complex

    • Site-directed mutagenesis targeting putative interaction sites

    • Complementation studies in bacterial strains lacking both proteins

  • Structural Biology Solutions:

    • Single-particle cryo-EM for complex structure determination

    • Lipid nanodisc incorporation to maintain native-like environment

    • Solid-state NMR for structural constraints in membrane environment

    • Computational modeling and molecular dynamics simulations

By implementing these approaches, researchers can overcome the inherent challenges of studying multi-component membrane protein complexes and gain insights into how MdtI and MdtJ cooperate to form a functional spermidine export system. Understanding this cooperation is critical since research has established that both components are necessary for spermidine export function .

What are the most critical unresolved questions regarding MdtI function in Salmonella Dublin?

Despite advances in understanding MdtI, several critical questions remain unresolved:

  • Structural-Functional Relationships:

    • What is the high-resolution structure of S. Dublin MdtI?

    • How does MdtI specifically recognize and transport spermidine?

    • What is the stoichiometry and arrangement of the MdtJI complex?

    • How do conformational changes drive the transport cycle?

  • Physiological Significance:

    • Is MdtI essential for S. Dublin survival under specific host conditions?

    • How does spermidine export contribute to S. Dublin's host adaptation in cattle?

    • Does MdtI function contribute to persistence in carrier animals?

    • What is the relationship between MdtI and the systemic spread that characterizes S. Dublin infections?

  • Antimicrobial Resistance Connections:

    • Does MdtI contribute directly or indirectly to the high rates of MDR in S. Dublin?

    • Are there functional interactions between MdtI and other resistance determinants?

    • How does antimicrobial exposure affect MdtI expression and function?

    • Could MdtI inhibition sensitize resistant S. Dublin to conventional antibiotics?

  • Regulatory Networks:

    • What transcription factors control mdtI expression?

    • How is mdtI expression regulated during different stages of infection?

    • Are there host-specific signals that modulate MdtI function?

    • Does cross-talk exist between virulence regulators and mdtI expression?

Addressing these questions will require integrative approaches combining structural biology, functional genomics, infection models, and systems biology. The answers would significantly advance our understanding of this protein's role in S. Dublin pathophysiology .

How might interdisciplinary approaches advance our understanding of MdtI's role in bacterial physiology and pathogenesis?

Interdisciplinary approaches offer powerful frameworks for comprehensively understanding MdtI's significance:

  • Structural Biology + Computational Sciences:

    • Cryo-EM structures combined with molecular dynamics simulations

    • Quantum mechanics/molecular mechanics for transport mechanism modeling

    • Machine learning for predicting functional effects of sequence variations

    • Virtual screening for potential MdtI inhibitors

  • Molecular Microbiology + Immunology:

    • Effects of MdtI function on host immune recognition

    • Impact of polyamine export on immune evasion strategies

    • Connections between MdtI and immunomodulatory bacterial factors

    • Host-specific differences in response to S. Dublin with altered MdtI function

  • Systems Biology + Veterinary Medicine:

    • Network modeling of MdtI's role in farm outbreaks

    • Epidemiological analysis of MdtI sequence variations

    • Predictive models for treatment outcomes based on MdtI function

    • Ecological modeling of S. Dublin persistence in dairy environments

  • Synthetic Biology + Drug Discovery:

    • Engineered MdtI variants with altered specificity

    • High-throughput screening platforms for MdtI inhibitors

    • Designed peptides targeting critical MdtI-MdtJ interfaces

    • Synthetic biology approaches to rewire polyamine metabolism

These interdisciplinary approaches would provide complementary insights that no single discipline could achieve alone, potentially revealing unexpected connections between MdtI function and S. Dublin's remarkable capacity to cause both enteric and systemic disease while developing extensive antimicrobial resistance .

What emerging technologies might accelerate research into MdtI and similar bacterial transport proteins?

Several cutting-edge technologies show promise for advancing MdtI research:

  • Advanced Structural Determination Methods:

    • Cryo-electron tomography for visualizing MdtI in native membranes

    • Microcrystal electron diffraction (MicroED) for small crystal analysis

    • Integrative structural biology combining multiple experimental constraints

    • Serial femtosecond crystallography with X-ray free-electron lasers

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational changes during transport

    • High-speed atomic force microscopy to visualize MdtI dynamics

    • Nanopore recording to measure single-channel transport events

    • Single-cell tracking of MdtI-fluorescent protein fusions during infection

  • Advanced Genetic Tools:

    • CRISPR interference for precise temporal control of gene expression

    • Base editing for introducing specific mutations without selection markers

    • Perturb-seq for high-throughput functional genetic screening

    • In situ genome engineering during infection models

  • Artificial Intelligence Applications:

    • Deep learning for predicting membrane protein structures

    • Neural networks for analyzing complex phenotypic data

    • AI-driven design of experiments to maximize information gain

    • Automated literature mining to integrate disparate research findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.