Recombinant Salmonella dublin Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Biological Function

MdtJ facilitates spermidine excretion to mitigate intracellular toxicity caused by polyamine overaccumulation. Key mechanistic insights include:

  • Spermidine Homeostasis: MdtJ, in concert with MdtI, exports spermidine at neutral pH, a critical function under stress conditions .

  • Essential Residues: Mutational studies in E. coli homologs identified residues critical for activity (e.g., Tyr 4, Trp 5, Glu 15 in MdtJ) .

  • Pathogenicity Link: While not directly studied in S. dublin, spermidine export systems in related pathogens influence survival in host environments .

Research Applications

Recombinant MdtJ is commercially available for biochemical and antimicrobial resistance studies:

SupplierCatalog NumberPriceApplications
MyBioSource.comN/A$1,390.00Protein interaction assays, antibody production
Creative BiomartRFL28804SFInquireStructural studies, drug resistance mechanisms
Colorectal ResearchN/A€1,462.00ELISA development, immunogenicity assays

Key Research Findings

  • Genetic and Functional Conservation: The mdtJ gene is conserved across Salmonella serovars (e.g., S. choleraesuis shares 100% sequence identity) , suggesting a universal role in polyamine regulation.

  • Mechanistic Insights from E. coli:

    • The MdtJI complex reduces intracellular spermidine levels by 50% under overaccumulation conditions .

    • Excretion activity is ATP-independent and requires both MdtJ and MdtI subunits .

  • Epidemiological Context: Multidrug-resistant (MDR) S. dublin strains carrying AMR plasmids are rising globally , though direct links between MdtJ and AMR remain unexplored.

Technical Considerations

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Avoid Freeze-Thaw Cycles: Repeated thawing degrades activity; aliquot storage at -80°C is recommended .

Future Directions

  • Pathogenicity Studies: Investigate MdtJ’s role in S. dublin virulence using knockout models.

  • Drug Development: Target spermidine export pathways to disrupt bacterial stress adaptation.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific needs. Please indicate your desired format in the order notes, and we will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please communicate your preference, and we will prioritize its development.
Synonyms
mdtJ; SeD_A1858; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MdtJ in Salmonella dublin?

MdtJ functions as part of the MdtJI complex that specifically catalyzes the excretion of spermidine from bacterial cells. This protein belongs to the small multidrug resistance (SMR) family of drug exporters and works in conjunction with MdtI to form a functional export complex. The primary physiological role appears to be protection against spermidine toxicity that would result from overaccumulation within the cell. Studies have demonstrated that both MdtJ and MdtI proteins are necessary for recovery from toxicity due to elevated intracellular spermidine levels, and the complex actively facilitates spermidine export . Experimental evidence shows that when the MdtJI complex is expressed, intracellular spermidine content decreases in cells cultured with high (2 mM) external spermidine concentrations .

What is the structural characterization of the MdtJ protein?

MdtJ is a 120-amino acid membrane protein from Salmonella dublin with the following sequence: MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI . Structurally, MdtJ contains multiple transmembrane domains characteristic of the SMR family proteins. Key functional residues have been identified through site-directed mutagenesis, including Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82, which are directly involved in spermidine export activity . These residues likely form part of the substrate binding pocket or transport channel. The protein's hydrophobic nature is reflected in its amino acid composition, which is rich in aliphatic and aromatic residues typical for a membrane-spanning protein. For structural studies, researchers typically use recombinant forms with affinity tags (such as His-tag) to facilitate purification and characterization .

How does the MdtJI complex function as a spermidine exporter?

The MdtJI complex functions through a coordinated mechanism requiring both protein components. Experimental evidence indicates that neither MdtJ nor MdtI alone can effectively protect cells against spermidine toxicity . The complex likely forms a heterodimer or higher-order oligomer within the cell membrane that creates a specific transport channel for spermidine. Functional studies reveal that the complex responds to elevated spermidine levels, as indicated by increased mdtJI mRNA expression in the presence of spermidine . The transport mechanism likely involves recognition of the positively charged spermidine molecule through interactions with specific negatively charged residues (glutamate and aspartate) in both MdtJ and MdtI. To study this mechanism, researchers can use radioactively labeled spermidine to track transport rates in cells expressing wild-type or mutant forms of the complex. Additionally, membrane vesicle studies with purified proteins can provide direct evidence of transport activity and kinetic parameters.

What are the optimal conditions for expressing and purifying recombinant MdtJ?

Recombinant MdtJ is typically expressed in E. coli expression systems using vectors that provide N-terminal or C-terminal affinity tags (commonly His-tag) for purification . For optimal expression, consider the following methodological approach:

  • Expression system selection: BL21(DE3) or similar E. coli strains are preferred for membrane protein expression

  • Vector design: pET-based vectors with T7 promoter systems allow controlled induction

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often yield better folding of membrane proteins

  • Membrane extraction: Efficient extraction requires appropriate detergents; n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) are commonly used

  • Purification strategy: Two-step purification using immobilized metal affinity chromatography followed by size exclusion chromatography

For storage, the purified protein should be maintained in a buffer containing Tris/PBS with 6% trehalose at pH 8.0, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.

How can researchers validate the functionality of recombinant MdtJ protein?

Validation of recombinant MdtJ functionality requires multiple complementary approaches:

  • Spermidine toxicity rescue assay: Transform the recombinant MdtJ and MdtI into an E. coli strain deficient in spermidine acetyltransferase (which normally detoxifies spermidine). Measure growth recovery in high-spermidine media compared to controls .

  • Spermidine export measurement: Measure intracellular and extracellular spermidine concentrations using HPLC or LC-MS in cells expressing the MdtJI complex versus controls.

  • Site-directed mutagenesis: Create mutants of the key residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) and test their effect on spermidine export function .

  • Reconstitution in liposomes: Purify both MdtJ and MdtI, reconstitute them in liposomes, and measure spermidine transport directly using radiolabeled substrate.

A typical validation experiment would include the following data table:

Experimental ConditionIntracellular Spermidine (nmol/mg protein)Extracellular Spermidine (μM)Growth (OD600) in 2mM Spermidine
Vector control45.3 ± 3.212.4 ± 1.80.35 ± 0.06
MdtJ only42.8 ± 2.914.2 ± 2.00.41 ± 0.08
MdtI only41.5 ± 3.515.6 ± 1.90.44 ± 0.07
MdtJ+MdtI22.7 ± 2.436.9 ± 3.20.89 ± 0.12

What experimental models are most appropriate for studying MdtJ function?

Several experimental models can be employed to study MdtJ function, each with specific advantages:

  • E. coli expression systems: Ideal for basic functional studies, particularly strains deficient in spermidine acetyltransferase to highlight export function .

  • Salmonella dublin mutants: Creating mdtJ knockout and complemented strains in the native organism provides physiologically relevant context.

  • Membrane vesicle systems: Inside-out membrane vesicles prepared from cells expressing MdtJI allow direct measurement of transport without cellular metabolism complications.

  • Proteoliposome reconstitution: Purified MdtJ and MdtI incorporated into artificial liposomes provide a defined system to study transport kinetics and substrate specificity.

  • Cell infection models: For studying the role of MdtJ in Salmonella pathogenesis, macrophage or epithelial cell infection models can reveal connections between spermidine export and virulence.

Each model system requires specific methodological considerations. For example, when using E. coli expression systems, researchers should ensure that native polyamine transport systems (like PotE) are considered in experimental design and data interpretation.

How does the MdtJI complex specifically recognize spermidine versus other polyamines?

The specificity of the MdtJI complex for spermidine likely involves recognition of both the unique charge distribution and molecular dimensions of spermidine. Research approaches to address this question include:

  • Competitive transport assays: Measure spermidine export in the presence of other polyamines (putrescine, cadaverine, spermine) to determine relative affinities.

  • Molecular docking and simulation: Develop structural models of the MdtJI complex and perform in silico docking of different polyamines to predict binding modes.

  • Substrate analogue studies: Test transport of spermidine analogues with modified chain lengths or charge distributions to identify critical recognition features.

  • Charge-neutralizing mutations: Systematically mutate the negatively charged residues in MdtJ (Glu15, Glu82) and MdtI (Glu5, Glu19, Asp60) to determine their roles in substrate recognition .

Current evidence suggests that the MdtJI complex has evolved specific interactions with the three positively charged amino groups of spermidine, likely through electrostatic interactions with the negatively charged residues identified in both proteins. The spacing between these charged residues may create a binding pocket that accommodates spermidine's specific dimensions.

What is the relationship between MdtJ expression and antimicrobial resistance in Salmonella dublin?

Salmonella Dublin demonstrates increasing prevalence of antimicrobial resistance (AMR) , and the potential relationship with MdtJ expression warrants investigation through:

  • Transcriptomic analysis: Compare mdtJ expression levels between antimicrobial-resistant and susceptible S. Dublin isolates using RNA-seq or qRT-PCR.

  • Genetic association studies: Analyze whether mutations in mdtJ or its regulatory regions correlate with specific AMR phenotypes across different S. Dublin lineages.

  • Functional studies: Determine if overexpression of MdtJI affects minimum inhibitory concentrations (MICs) of different antibiotics.

  • Polyamine-antibiotic interactions: Investigate whether spermidine export affects cellular accumulation of specific antibiotics through membrane potential changes.

Recent research has identified distinct S. Dublin lineages with novel hybrid plasmids encoding both AMR and mercuric resistance . This suggests potential co-selection of resistance mechanisms that might include altered polyamine transport systems. The emergence of North American clusters approximately 60 years ago and two distinct Australian lineages provides an opportunity to study whether mdtJ variations contribute to strain-specific antimicrobial resistance profiles or adaptation to different hosts.

How does the amino acid composition of MdtJ affect its membrane integration and function?

The hydrophobic nature of MdtJ (MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI) is critical for its membrane integration and function. To study this relationship:

  • Hydropathy analysis: Use computational tools to identify transmembrane regions and create topology models of MdtJ within the membrane.

  • Cysteine accessibility studies: Introduce cysteine residues at specific positions and use membrane-impermeable sulfhydryl reagents to map exposed regions.

  • Tryptophan fluorescence: Monitor the environment of native or introduced tryptophan residues to determine their location relative to the membrane.

  • Chimeric protein studies: Create chimeras of MdtJ with other SMR family transporters to identify regions essential for spermidine specificity versus general membrane integration.

The amino acid sequence reveals multiple hydrophobic segments that likely span the membrane, interspersed with charged residues that might line the transport channel. The specific residues identified as crucial for function (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ) suggest both structural and functional roles in the protein.

How should researchers interpret contradictory findings about MdtJ function across different bacterial species?

When encountering contradictory findings about MdtJ function across different bacterial species, researchers should consider:

  • Sequence divergence analysis: Compare MdtJ sequences from different species to identify conservation patterns in key functional residues.

  • Heterologous expression studies: Express MdtJ variants from different species in a common host to directly compare functional properties.

  • Physiological context differences: Evaluate whether differences in polyamine metabolism, membrane composition, or growth conditions might explain functional variations.

  • Experimental design variations: Carefully analyze methodological differences between studies, including protein expression levels, purification methods, and functional assays.

A systematic approach to reconciling contradictory findings involves creating a comparative table:

SpeciesMdtJ Key Residue ConservationExperimental SystemReported FunctionMethodological Considerations
S. dublinReference sequenceNative expressionSpermidine exportDirect measurement of export
E. coli92% identical, all key residues conservedHeterologous expressionSimilar functionHigher expression levels used
Species X78% identical, 2 key residues differentIn vitro reconstitutionDifferent substrate preferenceDifferent lipid composition
Species Y65% identical, multiple substitutionsNative expressionNo detectable functionDifferent polyamine metabolism

What statistical approaches are appropriate for analyzing MdtJ expression and functional data?

For robust analysis of MdtJ expression and functional data, researchers should consider:

  • Normalization methods for expression data:

    • Use multiple reference genes when performing qRT-PCR

    • Apply appropriate normalization for RNA-seq data (RPKM/FPKM/TPM)

    • Consider batch effects in multi-experiment comparisons

  • Statistical tests for functional comparisons:

    • ANOVA with post-hoc tests for multiple condition comparisons

    • Mixed-effects models when incorporating multiple variables

    • Non-parametric alternatives when normality cannot be assumed

  • Dose-response analysis for transport studies:

    • Fit transport data to appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Use regression analysis to determine Vmax and Km parameters

    • Apply Eadie-Hofstee or Lineweaver-Burk transformations for non-linear relationships

  • Multiple testing correction:

    • Apply Bonferroni or Benjamini-Hochberg procedures when testing multiple hypotheses

    • Calculate false discovery rates for high-throughput experiments

For time-course experiments measuring spermidine export, repeated measures ANOVA or mixed effects models are particularly appropriate. When comparing mutant variants, hierarchical clustering based on functional parameters can reveal relationships between amino acid changes and functional outcomes.

How can researchers assess the physiological significance of MdtJ in Salmonella dublin infection models?

To assess the physiological significance of MdtJ during Salmonella dublin infections, researchers should:

Given that Salmonella Dublin is host-adapted and causes invasive bloodstream infections , the role of MdtJ might be particularly important during specific infection stages. Research should consider that polyamine requirements may differ between environmental survival, gut colonization, and systemic spread phases of infection.

What are promising approaches for studying the structural dynamics of the MdtJI complex?

Advanced structural biology techniques offer promising approaches for elucidating MdtJI complex dynamics:

  • Cryo-electron microscopy (cryo-EM):

    • Can resolve membrane protein structures without crystallization

    • May capture different conformational states during transport cycle

    • Compatible with detergent-solubilized or nanodisc-reconstituted complexes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Reveals regions of conformational flexibility

    • Can detect substrate-induced conformational changes

    • Provides insights into protein dynamics during transport

  • Single-molecule FRET studies:

    • Measure distances between labeled residues during transport

    • Detect conformational changes in real-time

    • Identify rare or transient states in the transport cycle

  • Molecular dynamics simulations:

    • Model protein-lipid interactions in native-like membranes

    • Simulate spermidine binding and transport pathways

    • Predict effects of mutations on structure and function

These approaches can address key questions about how spermidine binding triggers conformational changes, how the two proteins in the complex coordinate their actions, and how the substrate is released to the extracellular environment.

How might MdtJ function contribute to Salmonella dublin pathogenesis and host adaptation?

The contribution of MdtJ to Salmonella dublin pathogenesis requires investigation through:

  • Comparative genomics:

    • Analyze mdtJ sequence variations across different S. Dublin lineages

    • Identify selective pressures on polyamine transport genes

    • Compare with host-generalist Salmonella serovars

  • Host microenvironment studies:

    • Measure polyamine concentrations in different host compartments

    • Determine if host polyamine responses affect bacterial survival

    • Investigate competition with host polyamine transport systems

  • Immune response interactions:

    • Determine if polyamine export affects host immune recognition

    • Investigate potential immunomodulatory effects of bacterial polyamines

    • Assess impact on antimicrobial peptide susceptibility

  • Co-evolution analysis:

    • Study whether mdtJ variations correlate with host species adaptation

    • Investigate potential co-evolution with other virulence factors

    • Assess functional integration with other adaptive mechanisms

Recent research has identified distinct populations of Vi antigen-negative S. Dublin circulating in different geographical regions , suggesting that adaptations in surface structures (including potential interactions with polyamine export systems) may be important for host adaptation and pathogenesis.

S. Dublin LineageGeographic DistributionMdtJ Sequence VariationAssociated Virulence TraitsResearch Implications
Global lineageWidespreadReference sequenceVariable AMR profileBaseline for comparisons
North AmericanNorth America (emerged ~60 years ago)Potential variations to be determinedSpecific AMR patternsEvolution of transport function
Australian Lineage 1AustraliaPotential variations to be determinedNovel hybrid plasmid with AMR and mercuric resistanceSelection pressure effects
Australian Lineage 2AustraliaPotential variations to be determinedDistinct resistance profileRegional adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.