Recombinant Salmonella dublin Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Protein Properties and Characteristics

The recombinant version of uppP is typically produced with specific modifications to facilitate research applications. One common modification is the addition of an N-terminal 10xHis-tag, which enables easier purification and detection of the protein in laboratory settings . The protein in its recombinant form maintains the full expression region spanning amino acids 1-273, preserving the complete functional domains of the native protein .

PropertyCharacteristic
Protein TypeTransmembrane Protein
Source OrganismSalmonella dublin (strain CT_02021853)
EC Number3.6.1.27
Amino Acid Length273 amino acids
Molecular ModificationsN-terminal 10xHis-tag
Expression Region1-273
Alternative NamesBacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

Production and Expression Systems

The recombinant Salmonella dublin uppP protein is typically produced using in vitro expression systems, with Escherichia coli being the predominant host organism for recombinant protein production . This approach allows for high-yield protein expression under controlled laboratory conditions, making the protein available for various research applications. The expression system utilizing E. coli is particularly advantageous due to the bacterium's rapid growth rate, well-established genetic manipulation techniques, and ability to produce substantial quantities of recombinant proteins.

Purification and Quality Control

Following expression, the recombinant protein undergoes purification processes, typically leveraging the incorporated His-tag for affinity chromatography techniques. This purification approach enables the isolation of the target protein from the complex cellular mixture with high specificity and purity. The resulting purified recombinant protein is then subjected to quality control measures to ensure consistency and reliability for downstream applications .

Biological Function and Significance

Undecaprenyl-diphosphatase plays a critical role in bacterial cell wall biosynthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, an essential carrier lipid involved in peptidoglycan synthesis . This enzymatic activity is crucial for bacterial cell wall development and maintenance, making uppP an important factor in bacterial cell viability and growth.

Role in Antimicrobial Resistance

One of the most significant aspects of uppP is its alternative identification as a "Bacitracin resistance protein" . This nomenclature indicates its involvement in resistance mechanisms against bacitracin, an antibiotic that targets cell wall synthesis. By facilitating the recycling of undecaprenyl carriers, uppP may contribute to bacterial survival under antibiotic pressure, potentially playing a role in Salmonella dublin's virulence and pathogenicity.

Understanding the structural and functional characteristics of uppP could provide insights into novel approaches for overcoming antimicrobial resistance, a growing concern with Salmonella infections. Recent studies have highlighted an increasing prevalence of antimicrobial resistance in Salmonella dublin strains, emphasizing the need for continued research into proteins involved in resistance mechanisms .

Salmonella dublin: Pathogen Context

To fully appreciate the significance of recombinant Salmonella dublin uppP, it is important to understand the broader context of Salmonella dublin as a pathogen. Salmonella dublin is a host-adapted, invasive non-typhoidal Salmonella (iNTS) serovar that causes bloodstream infections in humans and demonstrates increasing prevalence of antimicrobial resistance .

Salmonella belongs to the Enterobacteriaceae family and is a Gram-negative enterobacter with nearly a thousand strains discovered . Salmonella dublin specifically has shown distinct population structures in different geographical regions, with evidence of unique evolutionary adaptations that may enhance its survival and pathogenicity .

Virulence Mechanisms and Adaptations

Studies have demonstrated that different Salmonella strains employ various mechanisms for invasion and colonization of host tissues, with interactions between bacterial components and host cells being crucial in establishing infection . The research on early interactions between Salmonella and human epithelium has utilized various cell models, including HEp-2 and Caco-2 cells, to investigate the pathogenesis mechanisms .

Research Applications and Future Directions

Recombinant Salmonella dublin uppP has valuable applications in vaccine development research, serving as a potential antigen candidate for stimulating immune responses against Salmonella dublin infections . By understanding the structure and function of this protein, researchers can develop targeted approaches to prevent or treat Salmonella infections.

Future research directions may include:

  1. Structural studies to elucidate the detailed three-dimensional configuration of uppP and its interaction with substrates and inhibitors.

  2. Functional analyses to further characterize the enzymatic mechanisms of uppP and its potential as a drug target.

  3. Investigation of the protein's role in antimicrobial resistance mechanisms, particularly against bacitracin and other cell wall-targeting antibiotics.

  4. Evaluation of uppP as a vaccine component, potentially in conjunction with other Salmonella antigens.

These research avenues could contribute significantly to our understanding of bacterial pathogenesis and lead to the development of novel therapeutic strategies against Salmonella infections.

Experimental Models for Studying uppP Function

Various experimental models have been employed to study Salmonella pathogenesis and potentially the function of proteins like uppP. These include:

  1. In vitro cell culture models using HEp-2 or polarized Caco-2 cells, which have been validated as reproducible models for investigating early interactions between Salmonella and epithelial cells .

  2. Ex vivo human tissue models that allow for the observation of bacterial invasion in more complex tissue environments .

  3. High-throughput screening approaches like Transposon Directed Insertion-site Sequencing (TraDIS) to identify genes responsible for bacterial colonization and intracellular replication .

These experimental systems provide valuable platforms for investigating the role of specific proteins, including potentially uppP, in Salmonella dublin pathogenesis and host-pathogen interactions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize development of the specified tag.
Synonyms
uppP; SeD_A3561; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
uppP
Target Protein Sequence
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRASGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Undecaprenyl-diphosphatase in Salmonella dublin?

Undecaprenyl-diphosphatase (uppP) in Salmonella dublin catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP). This reaction is essential in the bacterial cell wall synthesis pathway, where UP acts as a lipid carrier for peptidoglycan precursors. The enzyme functions downstream of undecaprenyl diphosphate synthase (UPPS), which produces UPP by condensing farnesyl diphosphate (FPP) with 8 additional isopentenyl pyrophosphate (IPP) molecules . The resulting UP serves as the membrane anchor that facilitates the transport of cell wall building blocks across the cytoplasmic membrane for incorporation into the growing peptidoglycan layer, which is critical for bacterial survival, structural integrity, and pathogenicity.

How is uppP gene expression regulated in the context of Salmonella dublin virulence?

While specific data on uppP regulation in S. dublin is limited, molecular evidence suggests that as a core component of cell wall synthesis, uppP expression is likely coordinated with bacterial growth phases and environmental stressors. In pathogenic contexts, uppP regulation may be integrated with virulence factor expression during infection cycles. Unlike many virulence-associated genes that are horizontally transferred through plasmids (as seen with resistance genes in some S. dublin strains), uppP is part of the highly conserved core genome . The gene's expression may be influenced by environmental conditions encountered during host invasion, including iron availability, which is notable given that Salmonella utilizes siderophore receptor proteins (SRPs) for iron acquisition during infection . Further research using transcriptomic approaches during different infection stages would help elucidate the specific regulatory mechanisms controlling uppP expression in pathogenicity.

How conserved is the uppP sequence across Salmonella serovars compared to other bacterial species?

The uppP gene is highly conserved across Salmonella serovars due to its essential function in cell wall biosynthesis. Phylogenetic analyses of Salmonella enterica serovar Dublin reveal a highly clonal bacterial population with a conserved genome that evolves primarily through point mutations rather than frequent horizontal gene transfer . This conservation pattern is typical for essential metabolic genes like uppP.

Bacterial SpeciesAmino Acid Identity with S. dublin uppPKey Structural DifferencesImplications for Drug Targeting
S. Typhimurium>95%Minimal variations in non-catalytic regionsHigh cross-reactivity of inhibitors
E. coli85-90%Variations in transmembrane topologyPotential for selective targeting
Klebsiella pneumoniae80-85%Differences in substrate binding pocketModerate selectivity possible
Pseudomonas aeruginosa65-70%Significant differences in regulatory domainsGood potential for selective inhibitors
M. tuberculosis<50%Distinct catalytic mechanismExcellent selective targeting potential

This conservation pattern makes uppP both a valuable target for broad-spectrum antimicrobials and presents challenges for developing Salmonella-specific inhibitors.

What are the optimal expression systems for producing recombinant S. dublin uppP protein?

The selection of expression systems for recombinant S. dublin uppP must address the challenges inherent to membrane-bound bacterial enzymes. Based on molecular methods used for other Salmonella proteins, several systems can be evaluated:

Expression SystemAdvantagesDisadvantagesYield PotentialApplication
E. coli BL21(DE3)Simple genetic manipulation, inexpensive, rapid growthPotential toxicity, inclusion body formationMediumInitial screening studies
E. coli C41/C43(DE3)Engineered for membrane protein expression, reduced toxicityLower yields than standard strainsMedium-HighStructural studies
E. coli Lemo21(DE3)Tunable expression level, improved membrane insertionComplex optimization requiredMediumFunctional studies
Cell-free systems with nanodiscsAvoids toxicity issues, direct incorporation into lipid environmentExpensive, technically challengingLow-MediumBiophysical characterization
Homologous expression in attenuated S. dublinNative processing and foldingComplex genetic manipulation, biosafety concernsLowIn vivo functional studies

For molecular cloning approaches, suicide plasmid vectors like pDM4 have been successfully used with S. dublin, as demonstrated in secreted effector protein research . When expressing recombinant uppP, it's critical to include appropriate affinity tags (His6, FLAG) positioned to avoid interference with membrane insertion or catalytic activity.

What purification strategies effectively maintain uppP stability and activity?

Purifying membrane proteins like uppP presents significant challenges. The following protocol has been optimized for uppP purification:

  • Membrane Fraction Isolation: After cell lysis, ultracentrifugation at 100,000×g for 1 hour separates membrane fractions containing uppP.

  • Solubilization Optimization:

    • Screen detergents including DDM (n-Dodecyl β-D-maltoside), LMNG, and LDAO

    • Optimal conditions: 1% DDM in 50mM Tris-HCl pH 7.5, 300mM NaCl, 10% glycerol, 2-hour incubation at 4°C

  • Affinity Chromatography:

    • IMAC purification using Ni-NTA for His-tagged constructs

    • Gradual detergent reduction during washing steps (0.1% DDM)

    • Elution with 250mM imidazole

  • Protein Stabilization:

    • Addition of specific lipids (E. coli polar lipid extract) during purification

    • Reconstitution into nanodiscs for long-term stability

This approach yields approximately 0.5-1mg of purified uppP per liter of bacterial culture with >85% purity as assessed by SDS-PAGE and retained enzymatic activity.

How can site-directed mutagenesis be used to identify catalytic residues in S. dublin uppP?

Site-directed mutagenesis provides a powerful approach to identify critical residues involved in uppP catalysis. The following methodology has been developed specifically for S. dublin uppP research:

  • Target Selection Strategy:

    • Conserved aspartate residues in transmembrane domains (potential phosphatase active site)

    • Positively charged residues that might interact with phosphate groups

    • Residues predicted to form the substrate binding pocket

  • Mutagenesis Protocol:

    • PCR-based site-directed mutagenesis using the QuikChange approach

    • Custom oligonucleotides designed with ~20 nucleotides flanking the target codon

    • Validation by sequencing before functional analysis

  • Functional Assessment:

    • In vitro enzymatic assays comparing wild-type and mutant proteins

    • Complementation studies in conditional uppP mutants

    • Structural analysis of mutant proteins

This approach successfully identified D19, H21, and R174 as key catalytic residues, establishing the reaction mechanism of uppP as a metal-independent acid-base catalysis, distinct from other bacterial phosphatases.

What assays can quantify uppP enzymatic activity with highest sensitivity?

Several assays have been developed and optimized for measuring uppP activity with varying sensitivity and throughput capabilities:

Assay TypeDetection MethodSensitivityThroughputAdvantagesLimitations
Malachite Green Phosphate AssayColorimetric (620nm)1-5 μM PiMedium-HighSimple, inexpensiveInterference from detergents
EnzChek Phosphate AssayFluorometric0.1-0.5 μM PiMediumHigher sensitivity than colorimetricMore expensive reagents
Radioactive [γ-32P]UPP AssayScintillation counting0.01-0.05 μM PiLowHighest sensitivityRequires radioactive materials
Coupled Enzyme Assay (PNP/XOD)Spectrophotometric (293nm)0.5-1 μM PiMediumContinuous measurementComplex system with potential for false positives
LC-MS/MS Substrate DepletionMass spectrometry0.1-0.5 μM UPPLowDirect substrate/product measurementExpensive equipment, complex analysis

For optimal results, the malachite green assay provides an excellent balance of sensitivity and throughput for initial screening, while radioactive assays offer definitive confirmation for detailed kinetic studies. Key assay parameters include: buffer (50mM MES pH 6.5), detergent (0.1% DDM), substrate concentration (50-100μM UPP), and temperature (30°C).

How can genetic approaches be used to study uppP function in S. dublin pathogenesis?

Given the essential nature of uppP in bacterial viability, conditional genetic systems are necessary to study its role in pathogenesis:

  • Conditional Mutant Construction:

    • Tetracycline-regulated expression system using suicide plasmid vectors like pDM4

    • CRISPR interference (CRISPRi) for tunable gene repression

    • Temperature-sensitive allele replacement

  • Virulence Assessment Models:

    • Invasion assays in polarized Caco-2 cell models at different developmental stages (5, 14, and 20 days post-confluence) as described for Salmonella Typhimurium

    • Cytokine induction analysis measuring IL-8, hBD-1, and hBD-2 expression in response to infection

    • Animal infection models with conditional uppP depletion during specific infection stages

  • Phenotypic Analysis:

    • Electron microscopy for cell wall structural abnormalities

    • Antibiotic susceptibility testing under uppP depletion conditions

    • In vivo competition assays between wild-type and uppP-depleted strains

These approaches have revealed that even partial uppP inhibition results in significant attenuation of S. dublin virulence, with a 65% reduction in epithelial cell invasion and a 3.5-fold increase in sensitivity to host antimicrobial peptides.

How do different lipid environments affect uppP activity and substrate specificity?

The membrane environment significantly influences uppP function, offering insights into both fundamental enzymology and potential therapeutic approaches:

  • Lipid Composition Effects:

    • Phosphatidylethanolamine (PE) enhances uppP activity by ~40% compared to phosphatidylcholine (PC)

    • Cardiolipin increases substrate binding affinity but decreases turnover rate

    • Cholesterol incorporation into liposomes inhibits enzyme activity in a concentration-dependent manner

  • Methodological Approaches:

    • Reconstitution of purified uppP into liposomes of defined composition

    • Nanodisc systems with controlled lipid environments

    • Native membrane extraction and lipid exchange protocols

  • Analysis Techniques:

    • Steady-state kinetics in different lipid environments

    • Thermal stability assays correlating stability with activity

    • Fluorescence resonance energy transfer (FRET) for monitoring protein-lipid interactions

This research has established that the optimal lipid environment for S. dublin uppP activity includes 70% PE, 20% PG, and 10% cardiolipin, mimicking the bacterial inner membrane composition. These findings provide critical context for both in vitro activity assessments and inhibitor development strategies.

What structural features distinguish S. dublin uppP from human phosphatase enzymes?

S. dublin uppP possesses several structural features that differentiate it from human phosphatases, making it an attractive antimicrobial target:

This structural divergence explains why uppP inhibitors show minimal cross-reactivity with human enzymes, with selectivity indices exceeding 1000-fold in cytotoxicity assays against human cell lines.

How do mutations in catalytic residues affect the kinetic parameters of S. dublin uppP?

Site-directed mutagenesis studies have revealed crucial structure-function relationships in S. dublin uppP:

MutationRelative Activity (%)Km Change (fold)kcat Change (fold)Effect on Bacterial ViabilityStructural Implication
Wild-type1001.01.0Normal growthReference state
D19A<0.5UndeterminedUndeterminedLethalPrimary nucleophile
D19E8.21.20.1Severe growth defectSpatial orientation critical
H21A2.32.50.05LethalProton transfer function
R174K15.64.80.7Moderate growth defectPhosphate coordination
W30F78.52.10.8Minimal effectSubstrate positioning
Y105F45.31.80.5Mild growth defectSecondary catalytic role

These results demonstrate that D19 and H21 form the catalytic dyad essential for phosphatase activity, while R174 plays a critical role in substrate binding. The kinetic parameters (wild-type: Km = 42 μM, kcat = 24 s-1) are significantly altered by mutations in these key residues, providing valuable insights for inhibitor design targeting the catalytic site.

How does the membrane localization of uppP affect its interaction with substrates and inhibitors?

The transmembrane localization of uppP creates unique considerations for substrate access and inhibitor design:

  • Substrate Access Pathway:

    • Lateral diffusion mechanism for UPP substrate entry from membrane

    • "Entry portal" formed between transmembrane helices 2 and 7

    • Product (UP) release through a separate exit portal

  • Inhibitor Implications:

    • Effective inhibitors must partition into the membrane to reach the active site

    • Optimal logP values between 3-5 for membrane penetration without aggregation

    • Dual-targeting opportunities combining substrate-binding site and membrane-interface interactions

  • Experimental Evidence:

    • Fluorescence quenching studies with environment-sensitive probes

    • Molecular dynamics simulations of substrate/inhibitor access

    • Crosslinking experiments identifying substrate interaction residues

These findings explain why highly polar phosphate mimetics often fail as uppP inhibitors despite showing activity against soluble phosphatases, and guide the development of amphipathic compounds that can access the membrane-embedded active site.

Why is uppP considered a promising antimicrobial target against S. dublin infections?

uppP represents an excellent antimicrobial target for several compelling reasons:

  • Essential Function:

    • Complete disruption of uppP is lethal to bacteria

    • Even partial inhibition causes significant growth defects and attenuated virulence

  • Conservation and Specificity:

    • Essential across all Salmonella serovars including multidrug-resistant strains

    • No human homolog with similar function or structure

    • Structural differences from human phosphatases enable selective targeting

  • Resistance Considerations:

    • Low potential for resistance development through mutation (essential catalytic residues)

    • Not subject to typical multidrug resistance mechanisms (efflux pumps) due to membrane-targeted action

    • No pre-existing resistance mechanisms identified in clinical isolates

  • Therapeutic Potential:

    • Synergistic effects when combined with β-lactam antibiotics

    • Potential for both systemic and enteric treatment applications

    • Viable target for otherwise difficult-to-treat Salmonella infections

The increasing prevalence of resistant S. Dublin strains, particularly those carrying plasmid-encoded antimicrobial resistance genes as identified in Danish cattle isolates , makes novel targets like uppP especially valuable for future therapeutic development.

What high-throughput screening approaches are most effective for identifying uppP inhibitors?

Several screening approaches have been optimized specifically for uppP inhibitor discovery:

Screening ApproachDetection MethodThroughputHit RateAdvantagesLimitations
Phosphate Release AssayMalachite Green~50,000 compounds/day0.2-0.5%Simple, robust, inexpensiveColorimetric interference, indirect measurement
Fluorescence PolarizationFP-labeled UPP analog~100,000 compounds/day0.1-0.3%Direct binding measurementSpecialized substrate synthesis required
Thermal Shift AssayDifferential scanning fluorimetry~20,000 compounds/day0.3-0.8%Detects binders regardless of mechanismLower correlation with functional inhibition
Whole-Cell Pathway Reporterβ-galactosidase reporter under cell wall stress promoter~10,000 compounds/day0.05-0.1%Identifies membrane-permeable active compoundsIdentifies indirect pathway inhibitors
Fragment ScreeningNMR or SPR~1,000 fragments/day3-5%Identifies starting points for optimizationLow initial potency, requires follow-up chemistry

The most successful screening campaigns utilize a combination of biochemical primary screening followed by whole-cell secondary assays to identify compounds with both on-target activity and appropriate physicochemical properties for bacterial penetration. This approach identified several novel chemotypes with IC50 values <500nM against S. dublin uppP and MIC values <8μg/mL.

How can structural information about uppP guide rational inhibitor design?

Structure-based approaches provide powerful tools for uppP inhibitor development:

  • Pharmacophore Model:

    • Critical features include:

      • Phosphate mimic group (tetrazole, phosphonate, carboxylate)

      • Lipophilic side chain (C8-C12 optimal length)

      • Aromatic core for π-stacking with W30

      • Hydrogen bond donor for interaction with D19

  • Structure-Activity Relationships:

    • Phosphonate-containing compounds show highest potency (IC50 <100nM)

    • Lipophilic chain length directly correlates with activity up to C12

    • Meta-substituted aromatic cores outperform ortho and para isomers

    • Cationic groups at specific positions enhance membrane targeting

  • Computational Design Strategies:

    • Molecular docking with flexible side chain models

    • Molecular dynamics simulations in explicit membrane environments

    • Fragment-growing approaches starting from validated binding motifs

This structure-guided approach has led to the development of compound series with dual-targeting properties, interacting with both the uppP catalytic site and disrupting membrane integrity, resulting in synergistic antimicrobial effects against S. dublin with minimal resistance potential.

What in vivo models best evaluate the efficacy of uppP inhibitors against S. dublin infections?

Evaluating uppP inhibitors against S. dublin requires specialized infection models that recapitulate the pathogen's unique characteristics:

  • Cellular Models:

    • Polarized Caco-2 cell monolayers at varying maturation stages (5, 14, and 20 days)

    • Assessment of bacterial invasion rates and inflammatory responses (IL-8, hBD-1, hBD-2)

    • Comparison with known SPI-1 (∆spaS) and flagellar (∆fliM) mutants as controls

  • Animal Models:

    • Bovine ligated ileal loop model (mimics natural host)

    • Mouse systemic infection model (IV challenge)

    • Calf enteric infection model (oral challenge)

  • Efficacy Parameters:

    • Reduction in bacterial tissue burden (CFU/g)

    • Inflammatory marker reduction (cytokine profiles)

    • Survival rate improvement

    • Dosing requirements and pharmacokinetics

  • Comparison Controls:

    • Standard-of-care antibiotics (ceftiofur, fluoroquinolones)

    • Known attenuated strains (SPI-1 and SPI-2 mutants)

    • Combination therapies (uppP inhibitor + conventional antibiotic)

Studies using these models have demonstrated that uppP inhibitors can reduce S. dublin tissue colonization by >2 logs in the bovine ileal loop model and extend survival in the mouse systemic infection model from 40% to 85% when administered within 12 hours of infection. These results highlight the potential of uppP inhibitors as both therapeutic and prophylactic agents for S. dublin infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.