Recombinant Salmonella dublin Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction

Salmonella enterica serotype Dublin (S. Dublin) poses substantial risks to both animal and human health, particularly due to its increasing antimicrobial resistance . Salmonella utilizes fructose-asparagine (F-Asn) as a nutrient during inflammation through a series of enzymatic actions . A key component in the bacterium's resistance mechanisms and cell wall modification is the enzyme Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, commonly referred to as ArnC . ArnC is a glycosyltransferase involved in the synthesis of UndP-Ara4FN, a precursor to lipid A modification, which is crucial for polymyxin resistance .

ArnC: Structure and Function

ArnC is classified as a type-2 glycosyltransferase (GT-2) based on sequence similarity and is localized to the inner membrane . It forms a stable tetramer with C2 symmetry through interactions in the C-terminal region . Deletion of the arnC gene reduces the level of UndP-Ara4FN, confirming its role in the formation of UndP-Ara4FN .

ArnC in Lipid A Modification

ArnC is essential for modifying lipid A with 4-amino-4-deoxy-L-arabinose, a process that contributes to polymyxin resistance . The biosynthesis of 4-amino-4-deoxy-L-arabinose involves multiple enzymes encoded by the pmrE and arnBCADTEF loci . ArnC N-formylates Ara4N before its transfer to undecaprenyl-phosphate . The product of ArnC, undecaprenyl-phospho-4-deoxy-4-formamido-L-arabinose (C55P-Ara4FN), is then deformylated by ArnD to generate the final C55P-Ara4N donor .

Role of ArnD

ArnD, a deformylase, acts downstream of ArnC in the pathway . Deletion of the arnD gene leads to the accumulation of the formylated ArnC product, undecaprenyl-phospho-4-deoxy-4-formamido-L-arabinose (C55P-Ara4FN) . Salmonella typhimurium ArnD (stArnD) is membrane-associated and contains a NodB homology domain structure characteristic of the metal-dependent carbohydrate esterase family 4 (CE4) . ArnD efficiently deformylates C55P-Ara4FN in the presence of Co2+ or Mn2+, confirming its role in Ara4N biosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SeD_A2642; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase in bacterial antimicrobial resistance?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) catalyzes the transfer of the L-Ara4N moiety to undecaprenyl phosphate, which represents a critical step in lipid A modification pathways. The modified arabinose is ultimately attached to lipid A, which forms a key component of the bacterial outer membrane in Gram-negative bacteria like Salmonella dublin . This modification significantly alters the surface charge of the bacterial outer membrane, making it less negatively charged and thus reducing the binding affinity of cationic antimicrobial peptides such as polymyxin . Research has demonstrated that this mechanism contributes directly to polymyxin resistance and protection against other cationic antimicrobial peptides, which has significant clinical implications . The enzyme thus represents a crucial adaptation mechanism that enhances bacterial survival under antimicrobial pressure, making it an important target for understanding resistance mechanisms.

How does Salmonella dublin arnC differ from homologous enzymes in other bacterial species?

While the core enzymatic function of arnC is conserved across different bacterial species, important structural and functional differences exist between homologs. In Salmonella dublin, the enzyme is classified under EC 2.7.8.30 and is referred to as Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, while in Escherichia coli HS, it carries the EC number 2.4.2.53 . In Salmonella enterica subsp. enterica serovar Typhimurium str. LT2, a similar enzyme called PmrK (O52327) is classified as EC 2.4.2.43 and acts as a Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase . These classification differences reflect subtle but significant variations in substrate specificity and catalytic mechanisms. Additionally, sequence analysis reveals that while these proteins share core functional domains, they have evolved species-specific features that likely optimize activity within their respective bacterial environments. These differences can be important considerations when designing species-specific inhibitors or when using homology models for structural studies.

What are the key domains and active sites in the Salmonella dublin arnC protein structure?

The Salmonella dublin arnC protein (UniProt: B5FNT8) consists of 327 amino acids with several functionally important domains . The protein contains a characteristic glycosyltransferase domain that is responsible for binding UDP-activated sugars and facilitating their transfer to the acceptor molecule. The active site includes key catalytic residues involved in binding both the donor molecule (4-deoxy-4-formamido-L-arabinose) and the acceptor (undecaprenyl phosphate). Structural analyses suggest the presence of a transmembrane domain, consistent with the protein's localization to the inner membrane, where it can access its lipid substrate. Key conserved motifs include the DXD motif commonly found in glycosyltransferases, which coordinates divalent metal ions required for catalysis. Additionally, the C-terminal region contains several charged residues that likely interact with the phosphate group of the undecaprenyl phosphate substrate. Understanding these structural features is essential for interpreting experimental results and designing targeted inhibitors.

What are the optimal expression systems for producing recombinant Salmonella dublin arnC protein?

The optimal expression of recombinant Salmonella dublin arnC requires careful consideration of several factors due to its membrane-associated nature. E. coli-based expression systems have been successfully used, but modifications are necessary to overcome common challenges. The BL21(DE3) strain supplemented with rare codon plasmids (like pRARE) is recommended when expressing proteins with rare codons that are common in Salmonella genes . Temperature optimization is critical, with expression at lower temperatures (16-18°C) often yielding more soluble protein. Using fusion tags that enhance solubility, such as MBP (maltose-binding protein) or SUMO, can significantly improve yield and folding quality. For membrane protein expression, specialized vectors containing signal sequences for proper membrane targeting may be necessary. Alternatively, cell-free expression systems have shown promise for difficult-to-express proteins like arnC. When designing constructs, including a TEV (Tobacco Etch Virus) protease cleavage site between the protein and tag allows for subsequent tag removal without compromising protein stability.

The following table outlines recommended expression conditions based on compiled research findings:

ParameterRecommended ConditionRationale
Expression HostE. coli BL21(DE3) or RosettaRosetta provides rare codons for efficient translation
Growth MediumTB or 2YT with 2% glucoseRich media improves yield; glucose prevents leaky expression
Induction0.1-0.2 mM IPTGLower IPTG concentrations reduce formation of inclusion bodies
Temperature16-18°C post-inductionLower temperatures improve protein folding
Duration16-20 hoursExtended expression time at lower temperature
Fusion TagsMBP, SUMO, or His6MBP and SUMO enhance solubility
DetergentsDDM or LMNG for extractionCritical for maintaining stability of membrane-associated domains

What purification strategies are most effective for obtaining high-purity arnC for structural and functional studies?

Purification of membrane-associated proteins like Salmonella dublin arnC presents unique challenges that require specialized approaches. A multi-step purification strategy is typically necessary to achieve high purity suitable for structural and enzymatic studies. Initially, gentle cell lysis using either French press or sonication in buffer containing protease inhibitors is recommended to prevent degradation. For membrane extraction, a buffer containing 1-2% n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) has proven effective for solubilizing arnC while maintaining its functional conformation. Affinity chromatography, typically using Ni-NTA resin for His-tagged constructs, provides an efficient first purification step with minimal protein loss.

Following affinity purification, size exclusion chromatography (SEC) is essential for removing aggregates and ensuring monodispersity. For arnC specifically, Superdex 200 columns equilibrated with buffer containing 0.05-0.1% detergent and 150-200 mM NaCl at pH 7.5-8.0 have shown optimal results. When higher purity is required, an intermediate ion exchange chromatography step using either Q Sepharose or SP Sepharose (depending on the protein's isoelectric point) can be incorporated between affinity and size exclusion steps. Throughout purification, maintaining protein stability with glycerol (10-15%) and reducing agents like DTT or TCEP has been shown to improve protein stability and prevent aggregation. For structural studies, detergent exchange to more crystallization-friendly detergents like CYMAL-6 may be necessary in the final purification steps.

What are the most reliable assays for measuring arnC enzymatic activity?

Several complementary approaches can be employed to reliably measure arnC enzymatic activity, each with specific advantages depending on the research question. Radioisotope-based assays utilizing 14C or 3H-labeled UDP-4-deoxy-4-formamido-L-arabinose provide the highest sensitivity for quantifying transferred arabinose to the undecaprenyl phosphate acceptor. This approach involves separating the lipid product via thin-layer chromatography or organic extraction, followed by scintillation counting to measure incorporation rates. Alternatively, a coupled enzymatic assay that monitors the release of UDP during the transfer reaction can be developed by linking UDP production to NADH oxidation through pyruvate kinase and lactate dehydrogenase, allowing for continuous spectrophotometric monitoring at 340 nm.

For high-throughput screening applications, fluorescence-based assays using modified substrate analogs with FRET (Förster resonance energy transfer) pairs can detect conformational changes during catalysis. Mass spectrometry-based approaches are particularly valuable for confirming product formation and characterizing reaction intermediates with high specificity. When developing these assays, several critical parameters must be optimized, including buffer composition (typically containing Mg2+ or Mn2+ as cofactors), pH (optimal range typically 7.0-8.0), and detergent concentration (sufficient to maintain enzyme solubility without inhibiting activity). Additionally, assay validation should include controls for substrate specificity by testing related sugar nucleotides and lipid acceptors to confirm the enzyme's specificity toward its native substrates.

How can researchers effectively analyze genetic diversity in the arnC gene across Salmonella dublin strains?

Analyzing genetic diversity of the arnC gene across Salmonella dublin strains requires a comprehensive approach combining multiple genomic techniques. Whole genome sequencing (WGS) provides the foundation for such analysis, with both short-read (Illumina) and long-read (PacBio or Oxford Nanopore) technologies offering complementary advantages . For population-level studies, designing PCR primers targeting conserved regions flanking the arnC gene allows for targeted sequencing of this specific locus across large strain collections. Once sequence data is obtained, multiple sequence alignment tools like MUSCLE or MAFFT should be used to align arnC sequences, followed by phylogenetic analysis using maximum likelihood or Bayesian approaches to reconstruct evolutionary relationships.

For detecting single nucleotide polymorphisms (SNPs) and small indels, variant calling pipelines such as GATK or FreeBayes applied to aligned sequences against a reference genome provide high sensitivity. The vSNP approach, as used in studies of S. Dublin isolates, is particularly effective for phylogenetic analysis based on SNP patterns . Researchers should pay particular attention to non-synonymous mutations that might affect protein function and regulatory region variations that could impact expression levels. Recent studies on S. Dublin have revealed relatively low genomic diversity in this serovar compared to other Salmonella serovars, suggesting relatively recent evolutionary divergence or selective pressure maintaining genomic conservation . This phenomenon appears to be particularly relevant for genes involved in antimicrobial resistance, including the arnC gene, which shows highly conserved sequences across clinical isolates.

What structural prediction methods are most appropriate for arnC when crystallographic data is unavailable?

In the absence of crystallographic data for Salmonella dublin arnC, researchers can employ several computational approaches to predict structure with reasonable accuracy. Homology modeling represents the most reliable approach when suitable templates exist. For arnC, structural homologs from other bacterial species with solved crystal structures can serve as templates, although careful template selection is crucial – structures of related glycosyltransferases with sequence identity above 30% provide the most reliable models. Software such as SWISS-MODEL, I-TASSER, or Rosetta can generate initial models, which should then undergo refinement using molecular dynamics simulations to optimize membrane-protein interactions and ligand-binding regions.

For template-free modeling, AlphaFold2 and RoseTTAFold have revolutionized protein structure prediction and can generate high-confidence models even for proteins with distant or no homologs. These AI-based approaches are particularly valuable for membrane proteins like arnC where experimental structures are challenging to obtain. Critical validation of predicted structures should include Ramachandran plot analysis, DOPE (Discrete Optimized Protein Energy) scores, and ProSA web server evaluation. For functional interpretation, computational tools like SiteMap or FTMap can identify potential active sites and substrate-binding pockets within the predicted structure. Additionally, coevolutionary analysis using methods like EVcouplings can provide contact map predictions that serve as independent validation for structural models. These approaches collectively enable researchers to generate working structural models that can guide experimental design and interpretation even in the absence of crystallographic data.

How does the genomic context of arnC in Salmonella dublin provide insights into its regulation and functional relationships?

The genomic context of arnC provides valuable insights into its regulation and functional relationships within Salmonella dublin's antimicrobial resistance mechanisms. The arnC gene (also annotated as pmrF/pqaB in some strains) is typically part of the polymyxin resistance (pmr) operon, which includes several genes involved in lipopolysaccharide modification . This operon is under the control of the PmrA/PmrB two-component regulatory system, which responds to specific environmental signals including high Fe3+ concentration, mildly acidic pH, and the presence of antimicrobial peptides. The genomic organization places arnC in a functional context with other enzymes in the arabinose modification pathway, including arnA (bifunctional enzyme), arnB (aminotransferase), arnD (deformylase), and arnT (transferase), which collectively synthesize and incorporate modified arabinose into lipid A.

Comparative genomic analysis of this region across multiple Salmonella isolates reveals highly conserved gene arrangements, suggesting strong selective pressure to maintain this functional unit . Upstream regulatory elements often include binding sites for PmrA and potentially other transcription factors like PhoP, which coordinates with PmrA to regulate the operon in response to Mg2+ limitation. Genomic analysis also reveals potential horizontal gene transfer events, as similar operons exist in other Gram-negative pathogens, indicating the evolutionary importance of this antimicrobial resistance mechanism. Recent studies have identified intricate regulatory networks involving small RNAs and additional transcription factors that fine-tune expression of the arn operon, providing bacteria with precise control over lipid A modification in response to changing environmental conditions. Understanding these genomic relationships is crucial for interpreting experimental results and developing strategies to target this resistance mechanism.

How does arnC activity correlate with antimicrobial resistance profiles in clinical Salmonella dublin isolates?

Comprehensive analysis of clinical Salmonella dublin isolates has revealed a strong correlation between arnC expression/activity and resistance to polymyxin antibiotics and other cationic antimicrobial peptides. In a study examining 140 S. Dublin isolates from cattle across 21 U.S. states between 2014-2017, researchers found that 98% were resistant to four or more antimicrobials, with high resistance rates to sulfonamides (96%), tetracyclines (97%), aminoglycosides (95%), and beta-lactams (85%) . While this study didn't specifically measure arnC activity, the resistance profile is consistent with the multidrug-resistant phenotype often associated with lipid A modifications in Salmonella.

The relationship between arnC and antimicrobial resistance appears to be multifaceted. Strains with higher arnC expression typically show elevated minimum inhibitory concentrations (MICs) for polymyxins, but the correlation is not always linear due to redundant resistance mechanisms. Mutations in the arnC gene can affect enzyme efficiency, with certain amino acid substitutions associated with either enhanced or reduced polymyxin resistance. Interestingly, the activation of the arnC pathway can be triggered by exposure to sub-inhibitory concentrations of certain antibiotics, suggesting a regulatory crosstalk between different resistance mechanisms. For clinical isolates, arnC activity should be evaluated alongside plasmid profiles, as certain plasmids can carry additional resistance determinants that work synergistically with lipid A modifications. The most frequent plasmid types identified in resistant S. Dublin isolates include IncA/C2, IncX1, and IncFII(S), which may contain genes that interact with or regulate arnC expression .

What experimental approaches can differentiate between arnC-mediated resistance and other polymyxin resistance mechanisms?

Differentiating arnC-mediated polymyxin resistance from other resistance mechanisms requires a multi-faceted experimental approach. Gene deletion and complementation studies provide the most direct evidence of arnC involvement—creating an arnC knockout strain and measuring changes in polymyxin susceptibility, followed by complementation with the wild-type gene to restore resistance. For phenotypic analysis, modified lipid A can be extracted and analyzed using mass spectrometry (MALDI-TOF or LC-MS/MS) to directly detect the arabinose modifications on lipid A that are specifically catalyzed by the arnC pathway.

Transcriptional analysis using RT-qPCR or RNA-Seq can determine if arnC is upregulated under polymyxin exposure, while promoter-reporter fusions can visualize the activation of the arn operon under different conditions. To distinguish from other resistance mechanisms, researchers should concurrently analyze alterations in the PmrA/PmrB and PhoP/PhoQ two-component systems, which can confer polymyxin resistance through various pathways including arnC regulation. Additionally, screening for mutations in mgrB, phoPQ, and pmrAB, which can confer polymyxin resistance independent of arnC activity, is essential. Biochemical assays using fluorescently labeled polymyxin can directly measure binding to the bacterial outer membrane, with reduced binding indicating lipid A modifications.

The following table outlines a systematic approach to differentiating resistance mechanisms:

Experimental ApproacharnC-Mediated ResistanceOther Resistance Mechanisms
Gene knockout effectLoss of polymyxin resistanceResistance may persist if other mechanisms present
Lipid A structure (MS)4-amino-4-deoxy-L-arabinose modifications presentOther modifications (e.g., phosphoethanolamine) may be detected
Polymyxin bindingSignificantly reduced bindingVariable binding depending on mechanism
PmrA/PmrB analysisOften shows activating mutations or upregulationMay be wild-type in some alternative mechanisms
Cross-resistance profileSpecific pattern including polymyxin and related CAMPsMay differ depending on alternative mechanism
Transcriptional responseUpregulation of complete arn operonDifferent gene sets depending on mechanism

How can the arnC pathway be targeted for novel antimicrobial development to overcome resistance?

The arnC pathway represents a promising target for novel antimicrobial development to overcome resistance in Salmonella dublin and other Gram-negative pathogens. Several strategic approaches can be employed to inhibit this pathway. Structure-based drug design targeting the arnC active site is a primary approach, focusing on developing competitive inhibitors that mimic either the donor substrate (UDP-L-Ara4FN) or the acceptor substrate (undecaprenyl phosphate) but lack transferable groups. These inhibitors would block the catalytic activity of arnC without being processed as substrates. Allosteric inhibitors that bind outside the active site but induce conformational changes that prevent catalysis represent another promising strategy, especially for highly conserved enzymes like arnC where active site architecture may be too similar to host enzymes.

Antisense oligonucleotides or small interfering RNAs specifically targeting arnC mRNA could potentially reduce enzyme expression, though delivery across the bacterial membrane remains challenging. Alternatively, inhibitors of the regulatory systems controlling arnC expression, particularly the PmrA/PmrB two-component system, could indirectly suppress arnC activity. A particularly innovative approach involves developing "antibiotic adjuvants" that don't kill bacteria directly but restore sensitivity to existing antibiotics like polymyxins by blocking the resistance mechanism. For drug development efforts, high-throughput screening of chemical libraries using the enzymatic assays described earlier can identify initial hit compounds, while fragment-based approaches might be particularly suitable given the complex substrate requirements of arnC. Combination therapy approaches should be explored, where an arnC inhibitor is paired with polymyxin or other antimicrobials to achieve synergistic effects and prevent resistance development.

How can researchers design effective experimental controls when studying arnC function in antimicrobial resistance models?

Designing robust experimental controls is essential for reliable interpretation of arnC function studies in antimicrobial resistance models. For genetic manipulation experiments, multiple control strains should be included: a true wild-type strain (positive control for resistance), an arnC deletion mutant (negative control for enzyme activity), and a complemented strain expressing wild-type arnC from a plasmid (restoration control). Creating point mutants with substitutions in catalytic residues provides additional controls that distinguish between protein presence and enzymatic activity. When analyzing lipid A modifications, an arnC-overexpressing strain can serve as a positive control for maximum modification levels, while deletion of upstream pathway genes (like arnA or arnB) creates important negative controls that lack the substrate for arnC.

For resistance phenotyping, susceptibility testing should include multiple classes of antimicrobials beyond polymyxins to establish specificity of the resistance mechanism. Time-kill assays should be performed with both polymyxin-susceptible and resistant reference strains with well-characterized resistance mechanisms for comparison. When conducting transcriptional studies, researchers should include housekeeping genes with stable expression patterns as normalization controls, and measure expression of other genes in the arn operon to distinguish between specific effects on arnC versus general operon regulation. For in vivo infection models, carefully designed control groups should include both susceptible and resistant strains with different resistance mechanisms to allow proper attribution of virulence and persistence phenotypes to arnC-mediated modifications. When analyzing strain collections, inclusion of historical isolates collected before widespread polymyxin use provides important baseline data for natural variation in arnC sequence and expression.

What are the implications of arnC variation in Salmonella dublin for vaccine development and immunological research?

Variations in the arnC gene and its resulting modifications to lipid A have significant implications for vaccine development and immunological research targeting Salmonella dublin. Lipid A serves as a potent immunostimulatory molecule through interaction with Toll-like receptor 4 (TLR4), and modifications catalyzed by arnC can significantly alter this interaction. The addition of 4-amino-4-deoxy-L-arabinose to lipid A typically results in reduced recognition by TLR4, potentially allowing bacterial evasion of innate immune detection. This modification can affect the immunogenicity of whole-cell vaccine candidates by altering the inflammatory response they generate, with arnC-active strains potentially inducing weaker innate immune activation.

For subunit or glycoconjugate vaccines, the structural changes in lipopolysaccharide (LPS) resulting from arnC activity may create antigenic variation that must be accounted for in vaccine design. Researchers developing vaccines should consider including epitopes from both modified and unmodified LPS to ensure comprehensive protection. In reverse vaccinology approaches, arnC itself might represent a candidate antigen, particularly if surface-exposed domains are identified. From an adjuvant perspective, engineered LPS with controlled degrees of arnC-mediated modification could potentially serve as tailored adjuvants with specific TLR4-stimulating properties. When studying host-pathogen interactions, researchers must account for the heterogeneity in lipid A structure resulting from differential arnC expression across strains, as this can significantly impact experimental outcomes in immunological assays and infection models. Recent research on S. Dublin isolates suggests regional adaptations in virulence and resistance mechanisms, including lipid A modifications, which could necessitate region-specific considerations in vaccine development .

How can systems biology approaches integrate arnC function with broader bacterial adaptation networks?

Systems biology approaches offer powerful frameworks for integrating arnC function with broader bacterial adaptation networks in Salmonella dublin. Multi-omics integration represents a fundamental approach, combining transcriptomics, proteomics, metabolomics, and genomics data to construct comprehensive models of how arnC interacts with other cellular processes. RNA-Seq analysis under various stress conditions (low Mg2+, acidic pH, antimicrobial exposure) can identify co-regulated gene networks, while ChIP-Seq targeting transcription factors like PmrA can map the complete regulon controlling arnC expression. Proteomics approaches, particularly phosphoproteomics, can elucidate post-translational regulation of the two-component systems controlling arnC expression.

Network analysis tools can build interaction networks linking arnC to other resistance and virulence mechanisms, identifying hub proteins and key regulatory nodes. For functional validation of these networks, CRISPR interference (CRISPRi) libraries targeting nodes in the predicted network can systematically assess their impact on arnC expression and antimicrobial resistance. Mathematical modeling, particularly using ordinary differential equations or stochastic models, can simulate how changes in environmental conditions propagate through signaling networks to affect arnC expression and lipid A modification. Flux balance analysis can predict how lipid A modifications impact broader metabolic networks, potentially revealing unexpected metabolic vulnerabilities in resistant strains.

Evolutionary systems biology approaches, analyzing genomic data across diverse Salmonella strains, can identify co-evolving genes that functionally interact with arnC, revealing previously unrecognized functional relationships. Recent research on S. Dublin has identified distinct lineages with characteristic resistance profiles, suggesting complex evolutionary dynamics in the arnC-containing resistance networks . These systems-level insights can guide more targeted experimental approaches and identify potential combination therapies that exploit vulnerabilities in the broader adaptation network rather than focusing solely on inhibiting arnC itself.

What are the common pitfalls in analyzing arnC expression and activity, and how can researchers avoid them?

Researchers studying arnC expression and activity face several common pitfalls that can lead to misleading results if not properly addressed. When measuring gene expression using RT-qPCR, inappropriate reference gene selection can significantly distort results; researchers should validate reference gene stability under experimental conditions and use multiple references for normalization. Growth conditions dramatically impact arnC expression, with variables like media composition, pH, and divalent cation concentrations (particularly Mg2+ and Fe3+) potentially causing inconsistent activation of the PmrA/PmrB system. Standardizing these variables across experiments and including detailed reporting of growth conditions is essential.

For activity assays, using non-physiological substrate concentrations can lead to unrealistic kinetic parameters; researchers should determine Km values and ensure assays are conducted at substrate concentrations relevant to cellular conditions. When performing lipid extraction for detecting modified lipid A, incomplete extraction or degradation during processing can lead to underestimation of modification levels; including internal standards and optimizing extraction protocols for the specific strain being studied can mitigate this issue. In heterologous expression systems, improper membrane targeting or folding of arnC can result in inactive enzyme; researchers should confirm proper localization using fractionation experiments or fluorescent tagging approaches.

A particularly insidious pitfall is assuming that polymyxin resistance directly correlates with arnC activity without confirming lipid A modification status, as other resistance mechanisms may be present. To avoid this, researchers should directly analyze lipid A structure using mass spectrometry in conjunction with resistance phenotyping. Finally, laboratory evolution during serial passage can select for mutations affecting arnC regulation; researchers should minimize passages and regularly sequence verify strains to ensure genetic stability throughout experimental work.

What strategies can researchers employ to overcome the challenges of working with membrane-associated proteins like arnC?

Working with membrane-associated proteins like arnC presents unique challenges that require specialized approaches. For structural studies, detergent screening is essential, as no single detergent works optimally for all membrane proteins. Researchers should systematically test a panel of detergents (including DDM, LMNG, CYMAL, and digitonin) for their ability to extract arnC while maintaining its stability and activity. For proteins resistant to traditional detergent solubilization, newer amphipathic polymers like SMALPs (styrene maleic acid lipid particles) can extract proteins within their native lipid environment, potentially preserving functional interactions.

Expression optimization should explore membrane-specialized expression systems, including C41/C43 E. coli strains derived from BL21(DE3) with adaptations for membrane protein overexpression or Lemo21(DE3) strains that allow tunable expression levels. Fusion with membrane protein expression tags like Mistic (from Bacillus subtilis) can enhance membrane targeting and folding. For structural studies, lipidic cubic phase (LCP) crystallization offers advantages over traditional vapor diffusion for membrane proteins, while cryo-electron microscopy (cryo-EM) allows structure determination without crystallization, particularly valuable for conformationally heterogeneous proteins like transporters and enzymes.

Alternative approaches to traditional purification include the use of nanodiscs, which provide a more native-like phospholipid bilayer environment while maintaining water solubility. For functional studies, liposome reconstitution with controlled lipid composition can preserve activity that might be lost in detergent micelles. When traditional approaches fail, cell-free expression systems with supplied nanodiscs or liposomes allow direct insertion of newly synthesized protein into membrane mimetics. Finally, computational approaches are increasingly valuable, with molecular dynamics simulations providing insights into membrane protein-lipid interactions that may be critical for arnC function but difficult to capture experimentally.

How can researchers effectively use computational approaches to complement experimental studies of arnC function?

Computational approaches offer powerful complements to experimental studies of arnC function, particularly when experimental approaches face technical limitations. Molecular dynamics (MD) simulations can model arnC within a lipid bilayer environment, providing insights into membrane interactions, conformational dynamics, and substrate binding that may be challenging to capture experimentally. These simulations can predict the effects of mutations on protein stability and function, guiding the design of site-directed mutagenesis experiments. For substrate binding studies, molecular docking and virtual screening can efficiently evaluate large libraries of potential inhibitors or substrate analogs, prioritizing compounds for experimental validation and potentially accelerating drug discovery efforts.

Homology modeling remains valuable for predicting arnC structure when experimental structures are unavailable, while more advanced approaches using deep learning (AlphaFold2, RoseTTAFold) can achieve remarkable accuracy even for membrane proteins. Quantum mechanical/molecular mechanical (QM/MM) calculations can elucidate reaction mechanisms at the electronic level, providing insights into the catalytic mechanism that are difficult to obtain experimentally. For systems-level understanding, flux balance analysis can predict how changes in arnC activity might impact broader metabolic networks, while agent-based modeling can simulate the emergence of resistance in bacterial populations under different selection pressures.

Integrative modeling approaches that combine computational predictions with sparse experimental data (from crosslinking, HDX-MS, or SAXS experiments) can generate structural models more accurate than either approach alone. Machine learning algorithms trained on experimental data can identify patterns in sequence-function relationships across bacterial strains, potentially predicting resistance phenotypes from genomic data. When implementing these computational approaches, researchers should validate predictions with experimental data whenever possible, and clearly acknowledge model limitations and assumptions in publications. The combination of these computational methods with targeted experiments creates a powerful iterative approach for understanding arnC function across multiple scales, from atomic-level catalysis to population-level resistance dynamics.

What are the most promising directions for future research on arnC and bacterial antimicrobial resistance?

Future research on arnC and bacterial antimicrobial resistance should pursue several promising directions. Development of structure-based inhibitors of arnC represents a high-priority area, leveraging growing structural information to design specific molecules that can disrupt lipid A modification without affecting essential human pathways. These efforts should include fragment-based drug design approaches and virtual screening of large compound libraries. Investigating the relationship between arnC expression/activity and virulence in infection models will provide deeper understanding of the trade-offs between resistance and pathogenicity, particularly important as S. Dublin shows increasing prevalence of antimicrobial resistance in clinical settings .

Exploring species-specific variations in the arn pathway across different pathogens could reveal unique regulatory mechanisms and potentially species-specific vulnerabilities in antimicrobial resistance. Single-cell analysis techniques should be applied to investigate heterogeneity in arnC expression within bacterial populations, which may explain the persistence of susceptible subpopulations despite antimicrobial pressure. The potential for horizontal gene transfer of the arn operon or its regulatory elements deserves investigation, particularly given evidence of novel hybrid plasmids encoding both antimicrobial resistance and virulence factors in emerging S. Dublin lineages .

Developing rapid diagnostic methods to detect arnC-mediated modifications in clinical isolates could guide more effective antimicrobial therapy selection. Additionally, exploring combination therapies that pair polymyxins with inhibitors of the arnC pathway may restore efficacy of these important last-line antibiotics. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data from resistant isolates could identify additional targets for intervention in the broader resistance network. Finally, investigating the immunomodulatory effects of arnC-mediated lipid A modifications may reveal opportunities to enhance host immune responses against resistant pathogens.

How might advances in structural biology techniques enhance our understanding of arnC function and inhibition?

Advances in structural biology techniques promise to revolutionize our understanding of arnC function and create new opportunities for inhibitor development. Cryo-electron microscopy (cryo-EM) has undergone remarkable advancements in resolution capabilities, now routinely achieving near-atomic resolution for membrane proteins without the need for crystallization. This technique could reveal arnC structure in different conformational states during the catalytic cycle, providing insights into the reaction mechanism not accessible through static crystal structures. Complementary techniques like single-particle cryo-EM and cryo-electron tomography (cryo-ET) could visualize arnC in the context of the bacterial membrane, potentially revealing important interactions with other components of the lipid A modification machinery.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers valuable insights into protein dynamics and ligand-binding sites without requiring a complete structural determination, providing information about which regions of arnC undergo conformational changes upon substrate binding. Serial femtosecond crystallography using X-ray free-electron lasers (XFELs) enables structure determination from microcrystals at room temperature, potentially capturing physiologically relevant conformations of arnC. Solid-state NMR spectroscopy is increasingly applicable to membrane proteins and could provide atomic-level insights into arnC-lipid interactions within the membrane environment.

Integrative structural biology approaches combining multiple techniques (crystallography, cryo-EM, SAXS, XLMS, etc.) with computational modeling will likely yield the most comprehensive understanding of arnC structure and function. Time-resolved structural methods could potentially capture transient intermediate states in the catalytic cycle. As these advanced structural techniques reveal the molecular details of arnC function, structure-based drug design efforts will become increasingly precise, potentially leading to highly specific inhibitors that could be developed as antibiotic adjuvants to restore polymyxin sensitivity in resistant pathogens.

How can multi-disciplinary approaches advance our understanding of the role of arnC in bacterial pathogenesis and host interactions?

Multi-disciplinary approaches are essential for comprehensively understanding arnC's role in bacterial pathogenesis and host interactions. Integrating microbiology, immunology, structural biology, and systems biology can reveal the complex interplay between lipid A modification and host-pathogen dynamics. Advanced infection models combining tissue engineering and microfluidics can create "organs-on-chips" that mimic specific host microenvironments where S. Dublin encounters antimicrobial peptides, allowing real-time visualization of bacterial responses and arnC regulation. These platforms could be particularly valuable for understanding tissue-specific dynamics in host-adapted pathogens like S. Dublin, which shows distinct patterns of virulence and persistence in different host environments .

Immunological approaches using defined mutants with varying levels of arnC activity can elucidate how lipid A modifications shape host innate immune responses, particularly focusing on TLR4 signaling and downstream inflammation. Mass spectrometry imaging can map the spatial distribution of modified lipid A structures within infected tissues, potentially revealing microenvironment-specific regulation of arnC activity. Machine learning algorithms applied to multi-omics datasets from infected hosts could identify patterns linking arnC expression to specific host responses, generating testable hypotheses about host-pathogen interactions.

Collaborative approaches between medicinal chemistry and microbiology could develop probes that specifically label modified lipid A in living bacteria, enabling real-time tracking of arnC activity during infection. Veterinary and clinical medicine perspectives are crucial for understanding the real-world implications of arnC-mediated resistance in both livestock and human infections, particularly given S. Dublin's zoonotic potential and increasing antimicrobial resistance . These multi-disciplinary efforts will not only advance fundamental understanding of bacterial adaptation mechanisms but could also reveal novel approaches for therapeutic intervention that target the dynamic interface between bacterial resistance mechanisms and host defense systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.