Recombinant Salmonella dublin UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; SeD_A3502; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQDILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0114 protein YqhA in Salmonella dublin?

YqhA is a protein of the UPF0114 family found in Salmonella dublin (strain CT_02021853) with the Uniprot identification number B5FV19. It is encoded by the yqhA gene (ordered locus name: SeD_A3502) and consists of 164 amino acids forming a full-length protein . The UPF (Uncharacterized Protein Family) designation indicates that while the protein's structure has been determined, its specific functional characterization remains incomplete. YqhA is present across multiple Salmonella species, suggesting conservation of this protein within the genus .

What are the optimal storage conditions for recombinant YqhA protein?

For optimal stability and activity retention, recombinant YqhA protein should be stored at -20°C, and for extended preservation, storage at -20°C or -80°C is recommended. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized specifically for YqhA stability .

Important storage considerations include:

  • Avoiding repeated freeze-thaw cycles which can significantly compromise protein integrity

  • Preparing working aliquots to be stored at 4°C for up to one week only

  • When using the protein for experimental purposes, maintaining appropriate buffer conditions similar to the storage buffer to prevent denaturation

In which bacterial species is the YqhA protein found?

The YqhA protein has been identified across multiple bacterial species, predominantly within the family Enterobacteriaceae. These include:

Bacterial FamilySpecies
SalmonellaS. dublin, S. gallinarum, S. agona, S. paratyphi (A, B, C), S. schwarzengrund, S. newport, S. enteritidis PT4, S. choleraesuis, S. typhimurium
EscherichiaE. coli, E. fergusonii
ShigellaS. sonnei, S. boydii (serotype 4, serotype 18), S. dysenteriae (serotype 1), S. flexneri

This broad distribution across related bacterial genera suggests that YqhA serves a conserved function in these organisms, though potential specialized roles in host-adapted species like Salmonella dublin may exist .

What is the hypothesized role of YqhA in Salmonella dublin pathogenesis?

While the specific role of YqhA in Salmonella dublin pathogenesis has not been fully characterized, its conservation across multiple pathogenic Salmonella species suggests potential involvement in bacterial survival and virulence mechanisms. Salmonella dublin is host-adapted to cattle with the ability to evade the innate immune response and reduce inflammatory responses in the intestinal mucosa, facilitating systemic dissemination .

The membrane-associated nature of YqhA, as indicated by its hydrophobic amino acid regions, suggests it may play roles in:

  • Membrane integrity maintenance during host cell invasion

  • Transmembrane signaling during host-pathogen interactions

  • Contributing to survival within the diverse environments encountered during infection (intestinal lumen, intracellular niches, systemic circulation)

  • Potential involvement in antimicrobial resistance mechanisms, as S. dublin has been characterized as a multi-drug resistant pathogen

Research examining gene expression profiles during different stages of infection would help elucidate the specific contributions of YqhA to S. dublin pathogenesis.

How does YqhA protein potentially relate to Salmonella dublin's host adaptation and zoonotic potential?

Salmonella dublin has undergone adaptation to cattle through evolutionary processes involving gene acquisition, mutation, and loss of specific genes to optimize survival in the bovine host environment . YqhA, as a conserved protein across multiple Salmonella species, may contribute to this host adaptation process.

The adaptation of S. dublin to cattle has been linked to the selection of variants that can effectively:

  • Evade bovine innate immune responses

  • Reduce inflammatory responses in intestinal mucosa

  • Facilitate systemic dissemination within the host

As a zoonotic pathogen, S. dublin poses significant health risks to humans, with reported increases in hospitalization rates from 68% to 78% and mortality rates from 2.7% to 4.2% between 1996-2004 and 2005-2013 . Understanding YqhA's potential role in both host adaptation and zoonotic transmission could provide insights into developing targeted interventions.

What experimental approaches are recommended for studying YqhA protein-protein interactions?

To investigate YqhA protein-protein interactions, several complementary methodological approaches are recommended:

  • Affinity Purification coupled with Mass Spectrometry (AP-MS)

    • Express His-tagged YqhA protein using methods similar to those described for YqeK protein

    • Perform Ni-NTA affinity chromatography followed by additional purification steps

    • Identify interacting proteins through mass spectrometry analysis

  • Yeast Two-Hybrid (Y2H) Screening

    • Generate bait constructs containing yqhA gene

    • Screen against a prey library of proteins from Salmonella dublin

    • Validate potential interactions through secondary assays

  • Bacterial Two-Hybrid System

    • More suitable for membrane proteins like YqhA

    • Design constructs that accommodate the membrane-associated nature of the protein

  • Co-immunoprecipitation (Co-IP)

    • Generate specific antibodies against YqhA or use tag-based approaches

    • Validate interactions in native bacterial contexts

  • Microscopy-Based Approaches

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Particularly useful for visualizing interactions in cellular contexts

A multi-method validation approach is strongly recommended, as each technique has inherent limitations when working with membrane proteins like YqhA.

What is known about the relationship between YqhA and antimicrobial resistance in Salmonella dublin?

While direct evidence linking YqhA specifically to antimicrobial resistance mechanisms in Salmonella dublin is limited in the provided search results, understanding this potential connection is important given the significant multi-drug resistance (MDR) profile of S. dublin.

S. dublin has shown concerning trends in antimicrobial resistance:

  • 84% of isolates resistant to five or more antimicrobial classes

  • 57% resistant to seven or more antimicrobial classes

  • Increase from 29% to 79% in isolates resistant to one or more antimicrobial classes between 1996-2004 and 2005-2013

Resistance has been documented against multiple antibiotics including:

  • Ampicillin

  • Chloramphenicol

  • Neomycin

  • Tetracycline

  • Streptomycin

  • Sulfonamide

  • Amoxicillin/clavulanic acid

  • Ceftriaxone

Research hypotheses worth investigating include:

  • Whether YqhA contributes to membrane permeability affecting antibiotic penetration

  • Potential involvement in stress responses that enhance survival during antibiotic exposure

  • Possible regulatory roles affecting expression of resistance genes

Given the protein's predicted membrane localization, studying YqhA in the context of AMR mechanisms could yield valuable insights into S. dublin's multi-drug resistant capabilities.

What are the optimal methods for recombinant expression and purification of YqhA protein?

Based on successful protein purification protocols for similar bacterial proteins, the following optimized methodology is recommended for YqhA:

  • Recombinant Expression System:

    • Construct expression vector containing the yqhA gene (full 1-164 amino acid sequence) in pET28b vector with N-terminal His-tag

    • Transform into E. coli BL21(DE3) or other appropriate expression strains

    • Induce expression with IPTG at optimal concentration (typically 0.1-1.0 mM)

    • Conduct expression at lower temperatures (16-18°C) overnight to enhance proper folding

  • Purification Protocol:

    • Perform initial purification using Ni-NTA affinity chromatography

    • Apply sample at 1 mL/min flow rate

    • Elute using an imidazole gradient (typically 20-500 mM)

    • Dialyze overnight in low-salt buffer (20 mM Tris-HCl, 200 mM NaCl)

  • Secondary Purification:

    • Further purify using a HiTrap Heparin HP column

    • Equilibrate with balance buffer (25 mM Tris-HCl, 0.1 mM EDTA, 0.4 mM DTT)

    • Perform linear elution using elution buffer containing increased salt concentration

  • Final Polishing:

    • Conduct gel filtration chromatography using Superdex-200

    • Use buffer containing 25 mM Tris (pH 7.5), 500 mM NaCl, 5 mM EDTA, and 4 mM DTT

  • Storage Considerations:

    • Dialyze into storage buffer containing 20 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, and 500 mM NaCl

    • Add 50% glycerol for long-term storage

    • Aliquot and store at -20°C or -80°C

For membrane proteins like YqhA, consider adding mild detergents (0.1% n-dodecyl β-D-maltoside or similar) to maintain solubility during purification steps.

How can researchers optimize ELISA protocols for detecting YqhA protein in research samples?

To optimize ELISA protocols for YqhA detection in research samples, consider the following methodological approach:

  • Antibody Development and Selection:

    • Generate specific antibodies against YqhA using purified recombinant protein

    • Validate antibody specificity through Western blotting

    • For improved sensitivity, develop monoclonal antibodies targeting unique epitopes

  • ELISA Format Selection:

    • Direct ELISA: Simpler but potentially less sensitive

    • Sandwich ELISA: Recommended for complex samples with higher specificity requirements

    • Competitive ELISA: Useful for quantitative analysis

  • Protocol Optimization:

    • Coating concentration: Titrate from 1-10 μg/mL of capture antibody

    • Blocking: 2-5% BSA or milk protein in PBS

    • Sample preparation: Consider using Tris-based extraction buffer with mild detergents

    • Detection: HRP or AP-conjugated secondary antibodies

    • Substrate selection: TMB (3,3',5,5'-tetramethylbenzidine) for HRP systems

  • Sensitivity Enhancement Strategies:

    • Pre-enrichment of samples similar to methods used for Salmonella detection

    • Signal amplification using avidin-biotin systems

    • Extended substrate incubation under controlled conditions

  • Standardization:

    • Include purified recombinant YqhA as a positive control

    • Develop standard curves using known concentrations (1-1000 ng/mL)

    • Express results in optical density coefficient percentage (ODC%) similar to Salmonella detection ELISAs

  • Validation Parameters:

    • Establish cut-off values (e.g., 35 ODC% as used in Salmonella ELISAs)

    • Determine limits of detection and quantification

    • Assess cross-reactivity with related proteins from other bacterial species

This methodology draws upon established ELISA approaches used for detecting Salmonella antigens while being specifically optimized for YqhA protein detection.

What are the best approaches for conducting site-directed mutagenesis studies on YqhA protein?

For effective site-directed mutagenesis studies of YqhA protein, the following comprehensive approach is recommended:

  • Mutation Site Selection:

    • Identify conserved amino acid residues through sequence alignment of YqhA proteins across different species

    • Target hydrophobic regions potentially involved in membrane interactions

    • Focus on charged residues that may participate in protein-protein interactions

    • Consider evolutionary conservation patterns to identify functionally important regions

  • Primer Design Strategy:

    • Design primers containing the desired mutated amino acid sequences

    • Ensure primer length of 25-45 nucleotides with the mutation centrally located

    • Maintain GC content of 40-60% and terminate with one or more C or G bases

    • Check primers for self-complementarity and secondary structure formation

  • PCR-Based Mutagenesis Protocol:

    • Amplify the plasmid containing the yqhA gene using the mutagenic primers

    • Use high-fidelity DNA polymerase to minimize unwanted mutations

    • Digest the parental DNA template with DpnI endonuclease

    • Transform into competent E. coli cells

    • Verify mutations by DNA sequencing

  • Expression and Purification of Mutant Proteins:

    • Clone the mutated sequences into pET28b expression vector using restriction sites like NdeI and XhoI

    • Express and purify mutant proteins using the same protocol established for wild-type YqhA

    • Verify protein purity by SDS-PAGE and Western blotting

  • Functional Characterization of Mutants:

    • Compare structural properties of mutant and wild-type proteins

    • Assess membrane localization patterns

    • Evaluate protein-protein interaction capabilities

    • Measure functional activity in relevant assay systems

  • Data Analysis Framework:

    • Establish quantitative metrics for comparing mutant vs. wild-type properties

    • Use statistical analysis to determine significance of observed differences

    • Correlate structural changes with functional outcomes

This systematic approach will enable researchers to establish structure-function relationships for YqhA and potentially identify key residues involved in its biological role in Salmonella dublin.

How should experiments be designed to investigate YqhA's role in Salmonella dublin virulence?

A comprehensive experimental design to investigate YqhA's role in Salmonella dublin virulence should include multiple complementary approaches:

  • Gene Knockout and Complementation Studies:

    • Generate a ΔyqhA deletion mutant in Salmonella dublin

    • Create a complementation strain by reintroducing the wild-type yqhA gene

    • Develop point mutants targeting specific functional domains

    • Compare growth characteristics in standard laboratory media and under stress conditions

  • In Vitro Infection Models:

    • Assess invasion and intracellular survival in bovine intestinal epithelial cells

    • Examine interactions with bovine macrophages to evaluate:

      • Phagocytosis rates

      • Intracellular survival

      • Inflammatory cytokine production

    • Compare wild-type, ΔyqhA mutant, and complemented strains

  • Gene Expression Analysis:

    • Perform RNA-seq comparing wild-type and ΔyqhA mutant under:

      • Standard growth conditions

      • Conditions mimicking host environments (low pH, nutrient limitation)

      • Exposure to antimicrobial compounds

    • Validate key findings with RT-qPCR

  • Protein Localization and Interaction Studies:

    • Use fluorescent protein fusions to track YqhA localization during infection

    • Identify interaction partners through pulldown assays and mass spectrometry

    • Validate interactions using bacterial two-hybrid systems

  • In Vivo Models:

    • Design challenge studies in appropriate animal models

    • Compare colonization, tissue distribution, and persistence

    • Assess pathological changes and immune responses

    • Measure bacterial shedding patterns and duration

  • Antibiotic Susceptibility Testing:

    • Determine minimum inhibitory concentrations (MICs) for relevant antibiotics

    • Compare wild-type and ΔyqhA mutant susceptibility profiles

    • Assess acquisition rates of resistance under selective pressure

This multi-faceted approach will provide comprehensive insights into YqhA's contribution to S. dublin pathogenicity and host adaptation mechanisms.

What controls are essential when working with recombinant YqhA protein in experimental systems?

When designing experiments with recombinant YqhA protein, the following essential controls should be incorporated:

  • Protein Quality Controls:

    • Purity assessment through SDS-PAGE and silver staining

    • Western blot verification using anti-His tag antibodies

    • Mass spectrometry confirmation of protein identity

    • Circular dichroism to verify proper folding

    • Size-exclusion chromatography to assess aggregation state

  • Experimental Controls for Functional Assays:

    • Negative Controls:

      • Buffer-only controls to establish baseline measurements

      • Heat-denatured YqhA protein to distinguish structure-dependent activities

      • Non-related proteins with similar size/tag configurations

    • Positive Controls:

      • Known functional proteins from the same family if available

      • Commercially validated standards for enzymatic assays

      • Fresh vs. stored protein samples to assess stability effects

  • Specificity Controls:

    • Competition assays with unlabeled protein

    • Antibody blocking experiments

    • Dose-response relationships to confirm specific activity

  • Technical Controls:

    • Inter-assay calibrators to normalize between experimental runs

    • Internal standards for quantitative measurements

    • Replicate samples (minimum triplicates) for statistical validity

  • Storage and Handling Controls:

    • Time-course stability assessments under experimental conditions

    • Freeze-thaw cycle impact evaluation

    • Temperature sensitivity monitoring

  • Expression System Controls:

    • Empty vector expressions processed identically to YqhA

    • Host cell background controls

    • Tag-only protein controls when using tagged constructs

These comprehensive controls will ensure experimental rigor and reproducibility, allowing for confident interpretation of results obtained with recombinant YqhA protein.

What approaches would be most effective for studying potential inhibitors of YqhA function?

Developing a systematic approach to identify and characterize potential inhibitors of YqhA function requires a multi-tiered strategy:

  • Target Validation and Assay Development:

    • Establish a reliable functional assay for YqhA activity

    • Optimize assay conditions for reproducibility and sensitivity

    • Develop both primary screening assays and secondary confirmation assays

    • Validate assays using known modulators or structural analogues if available

  • Virtual Screening Approach:

    • Generate or obtain structural models of YqhA protein

    • Identify potential binding pockets through computational analysis

    • Perform in silico docking studies with virtual compound libraries

    • Prioritize compounds based on predicted binding energies and interactions

  • Biochemical Screening Methods:

    • Thermal shift assays to identify compounds that alter protein stability

    • Surface plasmon resonance or microscale thermophoresis to measure binding kinetics

    • Activity-based assays to directly measure inhibition of function

    • Screening should include:

      • Natural product libraries

      • Synthetic compound collections

      • Fragment-based approaches

      • Repurposing approved drugs

  • Structure-Activity Relationship (SAR) Studies:

    • Test structural analogues of initial hits

    • Synthesize derivatives to optimize potency and selectivity

    • Develop quantitative SAR models to guide further optimization

  • Cellular Validation:

    • Evaluate compound effects on Salmonella dublin growth and survival

    • Compare effects between wild-type and ΔyqhA mutant strains

    • Assess impact on virulence-associated phenotypes

    • Measure changes in gene expression profiles

  • Resistance Development Assessment:

    • Perform serial passage experiments in sub-inhibitory concentrations

    • Sequence YqhA from resistant isolates to identify resistance mutations

    • Use findings to refine inhibitor design

  • Mechanistic Characterization:

    • Determine mode of inhibition (competitive, non-competitive, etc.)

    • Identify binding sites through mutational analysis or structural studies

    • Assess effects on protein-protein interactions

This comprehensive pipeline will facilitate the discovery and development of effective YqhA inhibitors that could potentially serve as novel antimicrobial agents against Salmonella dublin.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.