Recombinant Salmonella dublin UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yfbV; SeD_A2684; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Salmonella dublin YfbV protein typically expressed and purified for research purposes?

Recombinant Salmonella dublin YfbV protein is typically expressed using E. coli expression systems. The procedure involves:

  • Gene synthesis/cloning: The yfbV gene (coding for amino acids 1-151) is synthesized or amplified and cloned into an expression vector such as pTrcHis2B .

  • Addition of tags: Commonly, a His-tag is added to the N-terminus or C-terminus to facilitate purification and detection . Alternative tags may include c-Myc tags depending on experimental requirements .

  • Expression conditions: The recombinant protein is expressed in E. coli under controlled conditions, often using IPTG induction if using T7 or Trc promoter systems .

  • Protein purification: Purification is typically achieved through affinity chromatography using the His-tag, followed by optional additional purification steps such as size exclusion chromatography.

  • Storage considerations: The purified protein is typically stored in a Tris-based buffer with 50% glycerol or with 6% Trehalose at pH 8.0 . Storage temperatures of -20°C or -80°C are recommended for extended storage, with working aliquots kept at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided .

For membrane proteins like YfbV, special consideration must be given to maintaining protein structure and function during solubilization and purification.

What are the comparative differences between YfbV from Salmonella dublin and other Salmonella serovars?

The YfbV protein shows high conservation across Salmonella serovars, but with subtle sequence variations that may influence functional properties:

Salmonella SerovarUniProt IDSequence Differences Compared to S. dublinSignificance
S. dublin (strain CT_02021853)B5FPH7Reference sequenceHost-adapted to cattle
S. typhiQ8Z521Single amino acid difference at position 110 (T→L)Human-specific pathogen
S. choleraesuisQ57M19Highly similar sequenceHost-adapted to pigs

What are the recommended conditions for handling and storing recombinant YfbV protein to maintain stability?

For optimal stability and activity of recombinant YfbV protein, the following handling and storage conditions are recommended:

  • Short-term storage: Working aliquots should be stored at 4°C for no more than one week .

  • Long-term storage: Store at -20°C or -80°C in appropriate buffer conditions .

  • Buffer composition: Tris-based buffer with 50% glycerol or 6% Trehalose at pH 8.0 provides optimal stability .

  • Reconstitution: If lyophilized, reconstitute to 0.1-1.0 mg/mL using deionized sterile water, followed by addition of glycerol (recommended final concentration 50%) before aliquoting for storage .

  • Freeze-thaw avoidance: Repeated freezing and thawing significantly reduces protein stability and should be strictly avoided .

  • Centrifugation before use: Brief centrifugation prior to opening vials is recommended to bring contents to the bottom, especially after transport or long storage .

These storage conditions have been optimized to maintain the native structure and function of the membrane protein, which is particularly important for experimental applications requiring biological activity.

How can YfbV be utilized in the development of vaccines against Salmonella dublin infections in cattle?

YfbV has potential applications in vaccine development against Salmonella dublin infections in cattle through several approaches:

  • As a carrier for antigenic epitopes: YfbV can be engineered as a carrier protein for presenting antigenic epitopes from other virulence factors. This approach has been demonstrated in similar systems where membrane proteins were used to display heterologous antigens .

  • Membrane anchoring strategy: The membrane-localization property of YfbV makes it an excellent candidate for anchoring chimeric vaccine constructs to bacterial outer membranes. Research has shown that chimeric proteins containing other Salmonella antigens can be successfully anchored to bacterial membranes using similar approaches to what might be applicable for YfbV .

  • Inactivated vaccine formulations: Similar to the study using chimeric EspB and Int280γ in Salmonella Dublin, YfbV could be incorporated into inactivated vaccine formulations. This approach has shown successful membrane anchoring of chimeric proteins in both Salmonella Dublin and ETEC, maintaining antigenic properties after inactivation with 0.2% v/v formalin for 96h at 4°C .

  • Stability in vaccine preparations: YfbV-based constructs have potential for long-term stability in vaccine preparations, as similar membrane protein-based vaccines have demonstrated antigen preservation for 2-7 months at 4°C .

  • What experimental approaches are most effective for studying the function of YfbV in Salmonella dublin infection models?

Several experimental approaches can be employed to investigate YfbV function in Salmonella dublin infection models:

  • Gene knockout and complementation studies:

    • Creating yfbV deletion mutants in S. Dublin using CRISPR-Cas9 or lambda Red recombination

    • Complementation with wild-type and mutated versions of yfbV

    • Assessment of mutant phenotypes in both in vitro and in vivo models

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interaction partners

    • Bacterial two-hybrid assays

    • Crosslinking studies followed by mass spectrometry to identify proteins in proximity to YfbV

  • In vivo infection models:

    • Calf infection models using wild-type and yfbV mutant strains

    • Monitoring of bacterial load, tissue distribution, and pathology

    • Infectious dose studies to determine if YfbV affects the minimum infective dose (currently established at 10^6 CFU for young animals)

  • Immunological studies:

    • Evaluation of host immune responses to YfbV

    • Assessment of cytokine profiles in response to wild-type vs. yfbV mutant infection

    • Determination of YfbV epitopes recognized by bovine immune system

  • Membrane biology approaches:

    • Membrane fractionation studies to confirm YfbV localization

    • Assessment of membrane integrity in yfbV mutants

    • Evaluation of YfbV's role in response to environmental stresses (pH, bile salts, antimicrobials)

These approaches should be conducted with appropriate controls and in compliance with animal welfare regulations. The incubation period of S. Dublin (12-72 hours) should be considered when designing time-course experiments.

How does the genomic context of the yfbV gene vary across different Salmonella dublin strains, and what implications does this have for bacterial evolution?

Analysis of genomic contexts of the yfbV gene across Salmonella dublin strains reveals important insights into bacterial evolution:

The limited genetic variation in S. Dublin compared to other Salmonella serovars suggests that yfbV and its genomic context may contribute to the host adaptation and persistence characteristics that make S. Dublin challenging to control in cattle populations.

What methodologies are available for investigating post-translational modifications of YfbV and their impact on protein function?

Investigating post-translational modifications (PTMs) of YfbV requires specialized methodologies:

When investigating PTMs in YfbV, particular attention should be paid to potential phosphorylation sites within the protein sequence, as bacterial membrane proteins are often regulated through phosphorylation events that affect their function or localization.

How can YfbV be utilized as a target for developing diagnostic tools for Salmonella dublin detection in cattle?

YfbV offers several promising avenues for developing sensitive and specific diagnostic tools for Salmonella Dublin detection in cattle:

  • Antibody-based detection systems:

    • Development of monoclonal or polyclonal antibodies against YfbV-specific epitopes

    • ELISA-based detection systems using recombinant YfbV as a capture antigen

    • Lateral flow immunoassays for rapid field testing

    • Immunomagnetic separation techniques for sample concentration prior to detection

  • Nucleic acid-based detection:

    • PCR primers targeting the yfbV gene for molecular detection

    • Loop-mediated isothermal amplification (LAMP) assays for field-friendly detection

    • Digital PCR for absolute quantification of bacterial load

    • Next-generation sequencing approaches for strain-level identification

  • Biosensor platforms:

    • Surface plasmon resonance (SPR) using immobilized anti-YfbV antibodies

    • Electrochemical impedance spectroscopy with YfbV-specific recognition elements

    • Aptamer-based detection systems targeting YfbV

  • Multiplex detection systems:

    • Combining YfbV detection with other S. Dublin-specific markers

    • Integration with detection systems for other cattle pathogens

    • Differentiation between S. Dublin and other Salmonella serovars based on YfbV sequence variations

  • Sample considerations:

    • Optimization for different sample types (feces, milk, blood, tissue)

    • Enrichment protocols to increase sensitivity

    • Protocols for handling intermittent shedding patterns in carrier animals

The development of YfbV-based diagnostics could address the current challenges in S. Dublin detection, particularly in identifying latent carrier animals that intermittently shed the bacteria without showing clinical signs, which are a major source of herd persistence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.