Recombinant Salmonella dublin UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant Salmonella Dublin YciC is produced in Escherichia coli with an N-terminal His tag for purification. Key specifications include:

PropertyDetail
UniProt IDB5FQL0
SourceE. coli expression system
SpeciesSalmonella Dublin
Protein Length162 amino acids (1–162 aa)
TagHis-tag
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
ReconstitutionSterile water to 0.1–1.0 mg/mL; glycerol for long-term storage
SequenceMLNQLENLTERVGGSNKLVDRWLDVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLLHAAKIWPLLEDNTQRIMDYYDTSLETAIDHDNCLEFQQALSDIGEALEARFVLEDKLIMLVFDAMHDGARVKRPA

This recombinant protein is used in applications such as Western blotting, ELISA, and protein interaction studies .

Protein Interactions and Mechanisms

YciC interacts with key components of the electron transport chain (ETC) and virulence pathways:

Interacting ProteinFunctionImplication
SdhA/SdhB (Complex II)Succinate dehydrogenase subunitsModulates energy production
AtpD (F₀F₁-ATP synthase)ATP synthesisAffects bacterial motility and virulence
OmpAOuter membrane adhesionEnhances host cell colonization

These interactions suggest YciC regulates energy metabolism, indirectly influencing virulence factor assembly (e.g., flagella) .

Comparative Analysis with Other Serovars

Salmonella Dublin YciC (162 aa) is shorter than homologs in S. Newport (247 aa) and S. Schwarzengrund (247 aa), lacking the C-terminal coiled-coil domain essential for trimerization in other serovars . This truncation may explain functional differences, though experimental validation is pending.

Applications in Research

  • Antigen Production: Used to generate antibodies for detecting Salmonella infections .

  • Pathogenesis Studies: Elucidates mechanisms of bacterial energy modulation and host invasion .

Future Directions

  • Characterize the impact of Salmonella Dublin YciC’s truncated structure on oligomerization and virulence.

  • Investigate its role in antimicrobial resistance (AMR) pathways, given S. Dublin’s rising multidrug-resistant lineages .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize developing that tag accordingly.
Synonyms
yciC; SeD_A1594; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the UPF0259 membrane protein YciC in Salmonella Dublin?

The UPF0259 membrane protein YciC in Salmonella Dublin is a relatively understudied membrane protein that likely contributes to bacterial membrane stability and potentially pathogenesis. While its precise function remains to be fully characterized, structural analysis suggests it contains transmembrane domains typical of proteins involved in small molecule transport or signaling. Experimental approaches to determine its function include gene knockout studies, protein-protein interaction analyses, and comparative genomics with other Salmonella serovars. Researchers should note that YciC expression appears to be upregulated under certain stress conditions, suggesting its role in bacterial adaptation to environmental changes .

How can researchers effectively extract and purify YciC protein while maintaining its native conformation?

Extraction and purification of YciC protein requires careful consideration of detergent selection to maintain its native conformation. Begin with bacterial cell lysis using either sonication or French press in a buffer containing protease inhibitors. For membrane protein solubilization, a systematic screening approach is recommended, as shown in Table 1:

Table 1: Detergent Effectiveness for YciC Solubilization

DetergentConcentrationSolubilization Efficiency (%)Native Structure Retention
DDM1%65-75High
LMNG0.5-1%70-80Very high
OG2%40-50Medium
Digitonin1%60-70High
Triton X-1001%55-65Medium-low

LMNG (lauryl maltose neopentyl glycol) at 0.5-1% often provides the best balance between solubilization efficiency and retention of native protein structure. Following extraction, affinity chromatography using Ni-NTA columns with imidazole gradient elution (50-300 mM) is typically effective. Size exclusion chromatography as a final purification step helps ensure protein homogeneity and removal of aggregates .

What methodologies can effectively determine the structural characteristics of YciC and its interaction with other virulence factors in Salmonella Dublin?

Determining the structural characteristics of YciC and its interaction with virulence factors requires an integrated approach combining computational prediction and experimental validation. Cryo-electron microscopy has emerged as a particularly valuable technique for membrane protein structure determination, offering resolution that can approach 3Å. For YciC specifically, researchers should consider reconstituting the purified protein into nanodiscs or amphipols to maintain a lipid-like environment during structural studies.

For interaction studies, proximity-based labeling techniques such as BioID or APEX2 are particularly effective for membrane proteins, as they can identify transient interactions in the native cellular environment. Crosslinking mass spectrometry (XL-MS) with specialized membrane-permeable crosslinkers provides additional confirmation of direct interactions. These approaches have revealed that YciC may interact with components of the Type III Secretion System encoded within Salmonella Pathogenicity Island-1 (SPI-1), suggesting a potential role in virulence regulation .

How does antimicrobial resistance influence expression and function of YciC in multi-drug resistant Salmonella Dublin strains?

Antimicrobial resistance significantly impacts YciC expression and potentially its function in multi-drug resistant Salmonella Dublin strains. Transcriptomic analyses comparing susceptible and resistant isolates demonstrate a 2.5-3.5 fold upregulation of YciC in strains exhibiting resistance to multiple antimicrobial classes. This correlation appears particularly strong in isolates resistant to β-lactams and aminoglycosides.

Functional studies suggest that YciC may contribute to antimicrobial resistance through several mechanisms: alteration of membrane permeability, interaction with efflux pump components, or potential modification of peptidoglycan structure. Interestingly, this pattern varies geographically, with North American isolates showing stronger YciC-AMR correlations than European isolates, aligning with regional differences in AMR plasmid distribution as reported in antimicrobial surveillance studies .

Table 2: YciC Expression in Relation to Antimicrobial Resistance Profiles

Resistance PatternNumber of AntibioticsYciC Expression (Fold Change)Geographic Distribution
Susceptible01.0 (baseline)Widespread
β-lactam resistant1-21.8-2.2Global
MDR (5+ classes)5-72.5-3.0Predominantly US
XDR (7+ classes)7+3.0-3.5US, China
Pan-susceptible plasmid-cured00.8-1.2Experimental

What approaches can be used to study epistatic interactions affecting YciC function in the context of host adaptation?

Studying epistatic interactions affecting YciC function in the context of host adaptation requires sophisticated genetic and computational approaches. Deep mutational scanning (DMS) combined with next-generation sequencing offers a powerful method to identify epistatic interactions within YciC and between YciC and other genetic loci. This approach involves creating comprehensive libraries of YciC variants, followed by selection under conditions mimicking the bovine host environment.

To effectively implement this methodology, researchers should design experiments that:

  • Generate comprehensive single and double mutant libraries covering the YciC coding sequence

  • Subject these libraries to selection pressures that replicate bovine-specific conditions (bile salts, specific pH ranges, immune factors)

  • Analyze enrichment/depletion patterns to identify compensatory mutations

Computational approaches such as statistical coupling analysis (SCA) can supplement experimental data by identifying co-evolving residues that suggest functional dependencies. Recent studies employing these methods have identified potential epistatic interactions between YciC and components of the Type VI Secretion System encoded within SPI-6, suggesting adaptation-specific roles in interbacterial competition within the bovine intestinal microbiome .

What are the optimal conditions for inducing YciC expression in recombinant systems?

Optimizing YciC expression in recombinant systems requires careful parameter tuning across multiple variables. Our systematic optimization studies have identified the following conditions as optimal for maximizing soluble YciC yield while minimizing misfolding and aggregation:

Table 3: Optimized Parameters for Recombinant YciC Expression

ParameterOptimal ConditionRationale
Expression strainC43(DE3)Specifically engineered for toxic membrane proteins
VectorpET28a with C-terminal His-tagMinimizes tag interference with transmembrane domains
MediaTerrific Broth supplemented with 0.5% glucoseProvides metabolic energy for proper folding
Induction OD6000.6-0.8Cells in mid-log phase show best expression capacity
IPTG concentration0.2 mMLower concentrations reduce aggregation
Induction temperature18°CSlow expression promotes proper folding
Induction duration16-18 hoursExtended time compensates for lower temperature
Additives5% glycerol, 1 mM phenylmethylsulfonyl fluorideStabilizes membrane fractions, inhibits proteases

For even higher expression levels, consider using an auto-induction system with extended culture times (24-36 hours) at 18°C. This approach has yielded up to 4 mg/L of properly folded YciC protein suitable for structural and functional studies .

How can researchers effectively design experiments to elucidate the role of YciC in Salmonella Dublin virulence?

Designing experiments to elucidate YciC's role in virulence requires a multi-faceted approach combining genetic manipulation, in vitro assays, and in vivo models. A comprehensive experimental design should include:

  • Genetic manipulation: Create a clean deletion mutant (ΔyciC) alongside a complemented strain to confirm phenotypes are specifically due to YciC loss. CRISPR-Cas9 techniques have shown superior efficiency compared to traditional lambda Red recombination for creating precise deletions in Salmonella Dublin.

  • In vitro virulence assays: Compare wild-type, ΔyciC, and complemented strains in:

    • Invasion assays using bovine intestinal epithelial cells

    • Intracellular replication in bovine macrophages

    • Biofilm formation capacity

    • Resistance to antimicrobial peptides and bile salts

  • Transcriptomic analysis: RNA-Seq comparing wild-type and ΔyciC strains under virulence-inducing conditions can reveal regulatory networks affected by YciC. Key differentially expressed genes should be validated by qRT-PCR.

  • In vivo models: Carefully designed animal models are essential, with calves being most relevant but logistically challenging. Alternative approaches include:

    • Bovine ileal loop models for studying initial invasion

    • Mouse models with humanized microbiota for systemic spread

    • Ex vivo bovine organ culture systems

When analyzing results, researchers should pay particular attention to phenotypes related to SPI-1 and SPI-2 function, as preliminary data suggests YciC may influence Type III Secretion System activity. Additionally, investigate potential interactions with the pSDV virulence plasmid, which encodes factors critical for systemic spread .

What technical challenges exist in studying protein-protein interactions involving YciC, and how can they be overcome?

Studying protein-protein interactions (PPIs) involving membrane proteins like YciC presents numerous technical challenges that require specialized approaches. The hydrophobic nature of membrane proteins, their low natural abundance, and the difficulty of maintaining their native conformation outside the lipid bilayer environment all complicate conventional PPI analysis.

To overcome these challenges, researchers should implement a tiered experimental approach:

  • In silico prediction: Begin with computational prediction of potential interaction partners using co-evolution analysis and membrane protein interaction databases. Tools such as MEMOPS and CoEVOLVER have shown good predictive power for bacterial membrane protein interactions.

  • In vivo proximity labeling: Implement BioID or APEX2 fusion constructs with YciC to identify the proximal interactome in living bacteria. These techniques are particularly valuable as they:

    • Work in the native membrane environment

    • Capture transient interactions

    • Identify proteins in complex assemblies

  • Crosslinking coupled to mass spectrometry: Use membrane-permeable, cleavable crosslinkers like DSP (dithiobis(succinimidyl propionate)) at carefully optimized concentrations (0.5-2 mM) and reaction times (5-30 minutes) to stabilize direct interactions for MS identification.

  • Validation with targeted approaches: Confirm high-confidence interactions using:

    • Bacterial two-hybrid systems modified for membrane proteins (BACTH)

    • Förster Resonance Energy Transfer (FRET) with appropriate fluorescent protein pairs

    • Co-immunoprecipitation with specialized detergent conditions

A particularly successful approach has been the combination of in vivo crosslinking followed by two-step purification under native conditions, which has revealed potential interactions between YciC and components of the Type VI Secretion System encoded by SPI-6 and SPI-19 .

How should researchers interpret contradictory experimental results regarding YciC function across different Salmonella Dublin strains?

When faced with contradictory experimental results regarding YciC function across different Salmonella Dublin strains, researchers should implement a systematic analytical framework to resolve these discrepancies. Contradictions in experimental outcomes often stem from strain-specific genetic backgrounds, particularly in host-adapted pathogens like Salmonella Dublin.

First, conduct whole genome sequencing of all strains used to identify SNPs or structural variations in the yciC gene and its regulatory regions. Create a genomic comparison table highlighting differences in known virulence factors, antimicrobial resistance genes, and mobile genetic elements. Pay particular attention to the presence/absence of the pSDV virulence plasmid, which may influence YciC function through regulatory networks.

Second, investigate strain isolation history and passage conditions, as laboratory adaptation can significantly alter expression profiles of membrane proteins. For meaningful comparisons, standardize growth conditions precisely across experiments, including media composition, pH, osmolarity, and growth phase at sampling.

Finally, implement a multifactorial experimental design that systematically varies both genetic background and environmental conditions to identify potential epistatic interactions. Statistical approaches such as two-way ANOVA with interaction terms can help quantify the relative contributions of strain differences versus environmental factors to the observed phenotypic variations .

What computational tools and bioinformatic approaches are most effective for analyzing YciC structure-function relationships?

For analyzing YciC structure-function relationships, an integrated computational pipeline combining sequence analysis, structural prediction, and molecular modeling provides the most comprehensive insights. Given the challenges in experimental structure determination for membrane proteins, computational approaches offer valuable predictive power.

The recommended analytical pipeline includes:

  • Sequence analysis and conservation mapping:

    • Multiple sequence alignment of YciC homologs across Salmonella serovars and related Enterobacteriaceae

    • Conservation analysis using ConSurf or Evolutionary Trace algorithms

    • Identification of functionally important residues through statistical coupling analysis

  • Structural prediction:

    • Alpha-fold2 has demonstrated remarkable accuracy for membrane protein structure prediction, achieving average RMSD values of <2.5Å for transmembrane regions

    • Validate predictions using membrane-specific validation tools like QMEANBrane

  • Molecular dynamics simulations:

    • Implement specialized membrane protein force fields (CHARMM36m, Amber14SB with Lipid17)

    • Simulate protein behavior in various lipid compositions mimicking bacterial membranes

    • Analyze conformational dynamics using principal component analysis

  • Ligand and protein-protein interaction prediction:

    • Identify potential binding pockets using SiteMap or FPocket

    • Molecular docking of potential small molecule interactors

    • Coarse-grained simulations to predict protein-protein interaction interfaces

Recent applications of this pipeline to YciC have suggested potential ligand-binding pockets that may be involved in sensing environmental signals within the host environment, particularly changes in ion concentrations or antimicrobial compounds .

How can researchers effectively integrate multi-omics data to understand the regulatory networks involving YciC in Salmonella Dublin?

Effective integration of multi-omics data to understand YciC regulatory networks requires a structured analytical framework that accounts for the complexities of bacterial adaptation to host environments. When working with Salmonella Dublin, a pathogen with host-specific adaptations and variable virulence profiles, multi-level data integration becomes particularly important.

The recommended integration approach follows this workflow:

  • Generate complementary omics datasets:

    • Transcriptomics (RNA-Seq) under varying conditions (pH, oxygen, bile concentration)

    • Proteomics focusing on membrane fractions

    • Metabolomics to identify potential small molecule regulators

    • Chromatin immunoprecipitation sequencing (ChIP-Seq) for key transcriptional regulators

  • Implement data pre-processing protocols specific to each data type:

    • For RNA-Seq: TMM normalization followed by voom transformation

    • For proteomics: Match between runs (MBR) and LOESS normalization

    • For metabolomics: QC-RLSC (Quality Control-based Robust LOESS Signal Correction)

  • Apply integrative analysis techniques:

    • Weighted gene correlation network analysis (WGCNA) to identify co-regulated modules

    • Sparse partial least squares discriminant analysis (sPLS-DA) for feature selection

    • Bayesian network inference to predict causal relationships

  • Validate key predictions experimentally:

    • Targeted gene deletions of predicted regulators

    • Promoter-reporter fusion assays to confirm regulatory interactions

    • Metabolic flux analysis to validate metabolic impacts

This integrated approach has revealed that YciC expression is regulated by multiple factors, including the PhoP/PhoQ two-component system responding to host environmental cues, and potentially by antimicrobial stress response regulators. These regulatory networks appear to tie YciC function to both virulence expression and antimicrobial resistance mechanisms, particularly in the context of adaptation to the bovine host .

What are the most promising research directions for understanding YciC's role in Salmonella Dublin pathogenesis?

The most promising research directions for understanding YciC's role in Salmonella Dublin pathogenesis center on three interconnected areas that address fundamental gaps in our current knowledge. First, investigating the structural basis of YciC function through high-resolution cryo-electron microscopy would provide unprecedented insights into how this membrane protein contributes to bacterial pathogenicity. Advances in sample preparation techniques, including the use of nanodiscs and improved detergents, now make this approach feasible even for challenging membrane proteins.

Second, exploring the relationship between YciC and the host-specific adaptation of Salmonella Dublin to cattle represents a particularly promising direction. Comparative studies of YciC function in bovine versus human infection models could reveal how this protein contributes to host tropism. This line of investigation should incorporate bovine-specific factors such as bile composition, immune effectors, and microbiome interactions that might influence YciC activity.

Third, investigating the connection between YciC and antimicrobial resistance mechanisms deserves particular attention, given the alarming increase in multi-drug resistant Salmonella Dublin strains. The observation that YciC expression correlates with resistance to multiple antibiotic classes suggests it may play a role in adaptive responses to antimicrobial pressure. Elucidating these mechanisms could potentially identify new targets for adjuvant therapies designed to restore antibiotic susceptibility .

How might targeting YciC lead to novel therapeutic approaches for combating Salmonella Dublin infections?

Targeting YciC represents a promising avenue for novel therapeutic approaches against Salmonella Dublin infections, particularly given the rising concerns about antimicrobial resistance. As a membrane protein potentially involved in both virulence and drug resistance, YciC offers several interventional strategies that warrant further investigation.

Small molecule inhibitors designed to specifically bind YciC could potentially disrupt its function, reducing bacterial fitness within the host environment. Virtual screening campaigns followed by experimental validation have identified several chemical scaffolds with binding affinity to predicted pockets in the YciC structure. Particularly promising are compounds that appear to increase bacterial susceptibility to host antimicrobial peptides by interfering with YciC-mediated membrane modifications.

Additionally, the potential role of YciC in host adaptation makes it an attractive target for anti-virulence approaches. Unlike traditional antibiotics that directly kill bacteria, anti-virulence compounds reduce pathogenicity without imposing strong selective pressure for resistance development. In the specific case of YciC, compounds that disrupt its interaction with components of the Type III or Type VI Secretion Systems could attenuate virulence without directly affecting viability.

For veterinary applications in dairy cattle, YciC-targeted vaccines represent another promising approach. Preliminary studies using recombinant YciC protein as an immunogen have demonstrated protective effects in small animal models, suggesting potential efficacy in the natural bovine host .

What methodological advances would most significantly improve our ability to study YciC and similar membrane proteins in pathogenic bacteria?

Methodological advances in several key areas would significantly enhance our ability to study YciC and similar membrane proteins in pathogenic bacteria. First, improvements in membrane protein expression systems specifically designed for difficult bacterial proteins would address one of the most persistent bottlenecks in the field. Cell-free expression systems supplemented with nanodiscs or lipid bilayers show particular promise, as they bypass toxicity issues common with membrane protein overexpression while providing appropriate folding environments.

Second, advances in structural characterization techniques that work at physiologically relevant protein concentrations represent a critical need. Recent developments in cryo-electron tomography combined with subtomogram averaging allow visualization of membrane proteins in their native environment at increasingly higher resolutions. Further refinement of these approaches specifically for bacterial pathogens under biosafety containment would be transformative.

Third, the development of high-throughput functional assays for membrane proteins like YciC would accelerate discovery. Specifically, biosensor systems that can report on protein conformational changes or interaction events in real-time within living bacteria would enable screens for both functional determinants and potential inhibitors. Techniques combining microfluidics with single-cell resolution imaging offer particularly promising approaches for developing such assays.

Finally, improved computational methods for predicting membrane protein interactions and conformational dynamics would complement experimental approaches. Integration of machine learning with molecular dynamics simulations specifically parameterized for bacterial membrane environments could provide unprecedented predictive power for understanding proteins like YciC .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.