Recombinant Salmonella dublin UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify it in your order for preferential development.
Synonyms
ycjF; SeD_A1648; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYAHLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RITTLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Salmonella dublin ycjF differ from homologous proteins in other Salmonella serovars?

Answer: Comparative genomic analysis reveals subtle but potentially significant differences between ycjF proteins from different Salmonella serovars. For example, when comparing S. dublin ycjF (B5FUK9) with S. typhimurium ycjF (Q8ZP64), there are several amino acid substitutions, particularly in positions that affect the transmembrane topology.

The key differences include:

PositionS. dublin ycjFS. typhimurium ycjFPotential Functional Impact
112I (Isoleucine)V (Valine)Minor hydrophobicity change
162H (Histidine)N (Asparagine)Change in charge properties
199A (Alanine)L (Leucine)Affects membrane packing
225T (Threonine)A (Alanine)Potential phosphorylation site

These differences may contribute to serovar-specific membrane properties or interactions with host environments, although direct experimental evidence linking these variations to functional differences remains limited .

What are the optimal expression systems for producing recombinant Salmonella dublin ycjF?

Answer: E. coli expression systems are the most commonly used and well-documented for producing recombinant Salmonella dublin ycjF. The methodology involves:

  • Vector selection: pET expression vectors (particularly pET28a) with N-terminal His-tag for purification purposes.

  • Host strain selection: BL21(DE3) or Rosetta(DE3) E. coli strains are preferred for membrane protein expression.

  • Induction conditions: IPTG induction at 0.5-1.0 mM when culture reaches OD600 of 0.6-0.8.

  • Temperature modulation: Expression at lower temperatures (16-25°C) after induction improves proper folding of membrane proteins.

  • Media optimization: Addition of glycerol (0.5-1%) and reduced salt concentration can improve expression yields.

For membrane proteins like ycjF, expression level optimization is critical to prevent toxicity and inclusion body formation. Alternative expression systems such as yeast (Pichia pastoris) may be considered for difficult-to-express variants, though E. coli remains the primary system of choice for research applications .

What are the most effective purification strategies for maintaining structural integrity of the ycjF protein?

Answer: Purification of membrane proteins like ycjF requires specialized approaches:

  • Membrane isolation: Cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent screening: Critical step involving testing multiple detergents (DDM, LDAO, OG) for optimal solubilization without denaturation.

  • IMAC purification: Utilizing the His-tag for immobilized metal affinity chromatography with gradient elution.

  • Buffer optimization:

    • pH range: 7.5-8.0

    • Salt concentration: 150-300 mM NaCl

    • Glycerol content: 5-10%

    • Detergent concentration: Just above CMC

  • Size exclusion chromatography: Final polishing step to isolate monodisperse protein and remove aggregates.

For structural studies, detergent exchange during purification may be necessary. The purified protein shows highest stability when stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, addition of 50% glycerol and storage at -20°C/-80°C is recommended to prevent freeze-thaw damage .

How should experiments be designed to investigate the membrane localization and topology of ycjF?

Answer: A comprehensive experimental approach to determine membrane localization and topology includes:

  • Fluorescent protein fusion studies:

    • Generate N- and C-terminal GFP/mCherry fusions

    • Perform confocal microscopy to visualize cellular distribution

    • Validate using membrane and cytoplasmic markers

  • Protease accessibility assays:

    • Create spheroplasts with accessible periplasmic regions

    • Perform limited proteolysis with proteases like trypsin

    • Analyze protected fragments by western blotting with domain-specific antibodies

  • Substituted cysteine accessibility method (SCAM):

    • Generate cysteine-less ycjF variant as background

    • Introduce single cysteines at predicted transmembrane boundaries

    • Treat with membrane-permeable and impermeable thiol-reactive reagents

    • Analyze labeling patterns to determine topology

  • Computational prediction validation:

    • Compare experimental results with predictions from TMHMM, HMMTOP, and Phobius

    • Resolve discrepancies through additional experimental approaches

This multi-faceted approach provides robust evidence for the membrane topology model, which is essential for understanding ycjF function in the bacterial membrane environment .

What approaches can be used to investigate potential protein-protein interactions of Salmonella dublin ycjF?

Answer: Multiple complementary approaches should be employed:

  • Co-immunoprecipitation with crosslinking:

    • Use membrane-permeable crosslinkers like DSP or formaldehyde

    • Solubilize membranes with mild detergents

    • Perform pull-down with anti-His antibodies

    • Identify interacting partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Use specialized membrane protein two-hybrid systems like BACTH

    • Create fusion libraries with T18/T25 domains

    • Screen for positive interactions via reporter gene activation

    • Validate with targeted pairwise tests

  • Proximity labeling approaches:

    • Generate ycjF-BioID or ycjF-APEX2 fusions

    • Perform in vivo labeling of proximal proteins

    • Isolate biotinylated proteins using streptavidin

    • Identify by LC-MS/MS analysis

  • Genetic interaction mapping:

    • Create ycjF deletion in combination with other gene deletions

    • Perform phenotypic profiling under various stress conditions

    • Identify synthetic lethal or sick interactions

    • Correlate with physical interaction data

For membrane proteins like ycjF, careful optimization of detergent types and concentrations is critical for maintaining natural interactions while achieving sufficient solubilization .

How does ycjF contribute to Salmonella dublin pathogenicity and host adaptation?

Answer: Investigating ycjF's role in pathogenicity requires multi-level experimental approaches:

  • Generation of clean deletion mutants:

    • Create ΔycjF strain using suicide vector systems (e.g., pDM4-based)

    • Construct complemented strains with wild-type and site-directed mutants

    • Verify deletions by PCR and phenotypic analyses

  • In vitro virulence characterization:

    • Assess growth in minimal media and under stress conditions

    • Measure invasion and replication in epithelial cell lines and macrophages

    • Determine resistance to antimicrobial peptides and oxidative stress

    • Compare with known virulence gene deletions (e.g., ΔspiC)

  • Animal infection models:

    • Determine LD50 in mouse models compared to wild-type

    • Track bacterial clearance from organs over time

    • Measure cytokine responses and histopathological changes

    • Assess protective efficacy against subsequent challenges

  • Transcriptomic and proteomic profiling:

    • Compare global gene expression between wild-type and ΔycjF

    • Focus on known virulence pathways and stress response systems

    • Validate key findings with RT-qPCR and western blotting

Recent studies with S. Dublin strain Sdu189 deletion mutants provide a methodological framework that can be adapted for ycjF functional studies, including protocols for virulence assessment, immune response characterization, and protective efficacy evaluation .

What is the relationship between ycjF genetic variation and antimicrobial resistance in Salmonella dublin?

Answer: Investigating potential connections between ycjF variants and antimicrobial resistance requires:

  • Genomic analysis pipeline:

    • Whole genome sequencing of diverse S. dublin isolates

    • Identification of ycjF sequence variants and nearby genetic elements

    • Correlation analysis with antimicrobial resistance genotypes and phenotypes

    • Phylogenetic mapping of variants onto resistance evolution trees

  • Experimental validation approaches:

    • Generation of isogenic strains with different ycjF variants

    • Antimicrobial susceptibility testing (MIC determination)

    • Growth kinetics under antibiotic selection pressure

    • Membrane permeability and efflux pump activity assays

  • Molecular mechanism investigation:

    • Heterologous expression of ycjF variants in susceptible backgrounds

    • Membrane composition and fluidity analysis

    • Protein-protein interaction studies focusing on transport systems

    • Transcriptomic analysis to identify compensatory mechanisms

Recent molecular epidemiology studies on S. Dublin have identified antimicrobial resistance patterns and genetic determinants that could potentially interact with membrane proteins like ycjF. Methodologically, hybrid assembly approaches combining short and long-read sequencing have proven valuable for identifying structural variations and mobile genetic elements that may influence resistance phenotypes .

How do recombination events affect the evolution of ycjF in Salmonella enterica subspecies?

Answer: Studying recombination impacts on ycjF evolution requires specialized evolutionary genomics approaches:

  • Comparative genomic analysis:

    • Compile ycjF sequences from diverse Salmonella enterica subspecies

    • Perform multiple sequence alignment and calculate sequence diversity metrics

    • Identify signatures of recombination using methods like PHI test, GARD, and ClonalFrameML

    • Map recombination breakpoints relative to protein domains

  • Population genetics calculations:

    • Calculate recombination to mutation ratio (ρ/θ) for ycjF versus genome average

    • Determine if ycjF is in recombination hotspots or coldspots

    • Compare selective pressures (dN/dS ratios) in recombinant versus non-recombinant regions

    • Test for biased gene flow between subspecies

  • Experimental validation:

    • Reconstruct ancestral ycjF sequences based on phylogenetic models

    • Express different evolutionary variants in common genetic background

    • Compare functional properties and fitness effects

    • Use transformation assays to measure recombination frequencies in laboratory settings

Research has shown that 14.44% of the Salmonella pan-genome shows evidence of recombination, with significant impacts on host adaptation and virulence. For membrane proteins like ycjF, recombination could affect membrane topology, protein-protein interactions, and ultimately bacterial fitness in different environments .

What are the main challenges in crystallizing membrane proteins like ycjF, and how can they be addressed?

Answer: Crystallizing membrane proteins presents several technical challenges:

  • Protein stabilization strategies:

    • Detergent screening: Systematic testing of >20 detergents (including DDM, LDAO, C12E8)

    • Lipid supplementation: Addition of specific lipids (PE, PG, cardiolipin) to maintain native-like environment

    • Thermostability assays: Use of CPM or FSEC-TS to identify stabilizing conditions

    • Use of fusion partners: T4 lysozyme, BRIL, or rubredoxin insertions at loop regions

  • Crystal formation optimization:

    • Lipidic cubic phase (LCP) crystallization as alternative to vapor diffusion

    • Bicelle crystallization methods with lipid-detergent mixtures

    • Use of antibody fragments (Fab, nanobodies) to increase polar surface area

    • Controlled dehydration protocols to improve diffraction quality

  • Alternative structural approaches:

    • Cryo-EM for single-particle analysis if protein size permits (>100 kDa)

    • NMR studies of selectively labeled protein in detergent micelles

    • Cross-linking mass spectrometry to obtain distance constraints

    • Computational modeling validated by experimental constraints

  • Quality control metrics:

    • Monodispersity assessment by SEC-MALS

    • Thermal stability monitoring by nanoDSF

    • Functional verification before and after purification

    • Lipid content analysis by mass spectrometry

Successful membrane protein crystallization typically requires testing hundreds of conditions and often benefits from iterative optimization based on initial crystallization hits .

How can researchers address contradictory results when studying ycjF function in different experimental systems?

Answer: Resolving contradictory results requires systematic troubleshooting:

  • Standardization of experimental conditions:

    • Create detailed protocols with explicit specification of strains, growth conditions, and reagents

    • Perform side-by-side comparisons in a single laboratory

    • Develop positive and negative control systems for each assay

    • Establish quantitative benchmarks for phenotypic assessments

  • Genetic background considerations:

    • Check for suppressor mutations that might arise during strain construction

    • Verify genotypes by whole genome sequencing rather than just PCR

    • Test phenotypes in multiple independent isolates

    • Consider epistatic interactions with strain-specific genetic elements

  • Environmental and physiological variables:

    • Standardize growth phase for all experiments (early log, mid-log, stationary)

    • Control media composition precisely, including trace elements

    • Monitor oxygen levels and pH throughout experiments

    • Test phenotypes across a range of stress conditions

  • Methodological cross-validation:

    • Apply multiple independent techniques to measure the same parameter

    • Validate antibody specificity with appropriate knockout controls

    • Use both tagged and untagged protein versions to verify function

    • Consider effects of protein overexpression versus native levels

When studying membrane proteins like ycjF, particular attention should be paid to membrane isolation procedures, as different methods can enrich distinct membrane subdomains, potentially leading to contradictory localization or interaction results .

How might ycjF be utilized in development of attenuated Salmonella vaccine strains?

Answer: Strategic approaches for exploring ycjF in vaccine development include:

  • Attenuation strategy evaluation:

    • Generate precise ycjF deletions or regulated expression constructs

    • Characterize attenuation level by LD50 determination in animal models

    • Compare with established attenuated strains (ΔaroA, ΔspiC)

    • Assess stability of attenuation through multiple passages

  • Immunogenicity assessment protocol:

    • Measure specific IgG antibody production over time

    • Quantify cytokine expression profiles (TNF-α, IFN-γ, IL-4, IL-18)

    • Track bacterial clearance from immunized animals

    • Examine histopathological changes in relevant tissues

  • Protective efficacy testing:

    • Challenge vaccinated animals with wild-type S. Dublin

    • Determine protection rates and survival curves

    • Measure bacterial loads in target organs

    • Assess cross-protection against heterologous serovars

  • Carrier potential for heterologous antigens:

    • Create chimeric constructs fusing ycjF with antigenic epitopes

    • Optimize expression systems for stability and immunogenicity

    • Evaluate immune responses to both Salmonella and heterologous antigens

    • Test protective efficacy against relevant pathogens

Research with S. Dublin deletion mutants has demonstrated that strategic gene deletions can create effective live attenuated vaccines with high safety profiles. YcjF could potentially serve as a novel target or as a vehicle for heterologous antigen delivery in next-generation vaccine development .

What emerging technologies could advance understanding of ycjF's role in membrane organization and cellular physiology?

Answer: Several cutting-edge technologies show promise:

  • Advanced imaging approaches:

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

    • Single-molecule tracking to monitor protein dynamics in live cells

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

    • Expansion microscopy for improved spatial resolution of protein complexes

  • Membrane protein interactomics:

    • APEX2-based proximity labeling in native membrane environments

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Native mass spectrometry of membrane protein complexes

    • Microfluidics-based single-cell protein-protein interaction detection

  • Functional genomics tools:

    • CRISPRi for tunable repression of ycjF expression

    • CRISPR-Cas9 scanning mutagenesis for high-resolution functional mapping

    • Perturb-seq to link ycjF function to global transcriptional responses

    • Synthetic genetic array analysis for comprehensive genetic interaction mapping

  • Computational integration approaches:

    • Machine learning models to predict membrane protein interactions

    • Molecular dynamics simulations in complex membrane environments

    • Systems biology modeling of membrane protein networks

    • Evolutionary coupling analysis to predict functional residues

These technologies could particularly advance understanding of how ycjF contributes to membrane organization, protein complex assembly, and ultimately virulence and antimicrobial resistance in Salmonella .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.