Recombinant Salmonella dublin UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Genomic and Functional Annotation

  • The yjjB gene is conserved across multiple Salmonella serovars (e.g., S. schwarzengrund, S. gallinarum) and E. coli .

  • It is classified under the UPF0442 family, a group of hypothetical proteins with uncharacterized enzymatic or structural roles .

  • Pathway Involvement: No specific pathways are currently linked to YjjB, though related effector proteins (e.g., SopB, SopD) in Salmonella are implicated in virulence via modulation of host cell signaling .

Comparative Analysis

Recombinant YjjB homologs from other species share identical sequences but differ in strain-specific annotations:

SpeciesLocus TagUniProt ID
S. dublinSeD_A4959B5FTA5
S. schwarzengrundSeSA_A4799B4TU22
S. gallinarumSG4375-
E. coliECK4353-

Experimental Use Cases

  • Antigen Production: Used in ELISA and immunoblotting to generate antibodies for detecting Salmonella infections .

  • Structural Studies: Full-length expression supports crystallization and functional domain mapping .

  • Pathogenesis Studies: While YjjB’s role remains unconfirmed, its recombinant form enables comparative analyses with characterized virulence factors like SopB (an inositol phosphatase) and SopD (a fluid secretion inducer) .

Key Challenges and Gaps

  • Function Unknown: Despite widespread availability, YjjB’s biochemical activity and contribution to Salmonella virulence are unverified .

  • Limited In Vivo Data: No peer-reviewed studies directly link YjjB to host-cell interactions or inflammatory responses, unlike SopB/SopD .

Future Directions

  • Functional Characterization: Enzymatic assays (e.g., phosphatase activity screening) could clarify YjjB’s role.

  • Host Interaction Studies: Knockout mutants or transfection models may reveal its impact on epithelial signaling.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
yjjB; SeD_A4959; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Salmonella dublin UPF0442 protein yjjB?

Salmonella dublin UPF0442 protein yjjB is a membrane protein found in Salmonella enterica serovar Dublin. It is a 157-amino acid protein with a molecular weight of approximately 17,047 Da . The protein is also known by synonyms including yjjB, SeD_A4959, and UPF0442 protein YjjB . It belongs to the UPF0442 protein family and functions as a multi-pass membrane protein embedded in the bacterial cell membrane . While its exact biological function remains to be fully characterized, it exists within the context of a pathogen known for its invasive properties and resistance to antibiotics .

What is the amino acid sequence and structural characteristics of yjjB protein?

The full amino acid sequence of Salmonella dublin UPF0442 protein yjjB consists of 157 amino acids: "MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIEWSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEPMMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV" . Structural analysis indicates that yjjB is a multi-pass membrane protein, suggesting it spans the cell membrane multiple times . This characteristic is consistent with its classification in the UPF0442 family. The hydrophobic regions within the sequence indicate transmembrane domains that anchor the protein within the bacterial membrane, which is typical of proteins involved in membrane transport or signaling functions.

How does yjjB relate to Salmonella dublin virulence?

While yjjB is not explicitly identified as one of the main virulence factors in Salmonella dublin based on the current literature, it exists within a bacterial species that possesses a complex array of virulence determinants . Salmonella dublin is known to harbor several virulence factors that contribute to its pathogenicity, including Gifsy-2 prophage, two different type 6 secretion systems (T6SSs) in Salmonella pathogenicity islands SPI-6 and SPI-19, and virulence genes like ggt and PagN . Understanding yjjB's potential interaction with these established virulence factors could provide insights into bacterial pathogenesis mechanisms. Notably, membrane proteins often play roles in bacterial adaptation to host environments and may contribute to antibiotic resistance, which is a significant concern with Salmonella dublin strains .

What are the optimal conditions for reconstitution of recombinant yjjB protein?

For optimal reconstitution of lyophilized recombinant yjjB protein, researchers should follow these methodological steps:

  • Centrifuge the protein vial briefly before opening to ensure the product is collected at the bottom of the vial .

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) .

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

The reconstitution buffer typically used is Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability . Given the membrane nature of the protein, researchers might need to consider the addition of mild detergents to improve solubility while maintaining native conformation, though this should be optimized experimentally.

How can researchers verify the purity and activity of recombinant yjjB protein?

Researchers can verify the purity and functional integrity of recombinant yjjB protein through multiple analytical approaches:

  • SDS-PAGE analysis: Commercial recombinant preparations typically guarantee purity greater than 90% as determined by SDS-PAGE . Researchers should perform their own SDS-PAGE analysis to confirm this purity level after reconstitution.

  • Western blotting: Using antibodies specific to the His-tag or to yjjB protein itself can confirm the identity of the protein.

  • Mass spectrometry: For detailed characterization, mass spectrometry can verify the exact molecular weight (expected to be approximately 17,047 Da) and confirm the protein sequence .

  • Circular dichroism (CD) spectroscopy: This technique can assess the secondary structure of the protein, ensuring it has folded correctly after reconstitution.

  • Functional assays: As a membrane protein, liposome incorporation studies or membrane interaction assays can evaluate functional activity, though specific assays would need to be developed based on the hypothesized function of yjjB.

What expression systems are most effective for producing recombinant yjjB protein?

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay have issues with proper folding of membrane proteins
YeastBetter for eukaryotic proteins, post-translational modificationsLonger production time, more complex media
BaculovirusGood for complex proteins, higher eukaryotic post-translational modificationsMore expensive, technically demanding
Mammalian cellsHighest fidelity for eukaryotic proteinsMost expensive, lowest yields, longest production time

For membrane proteins like yjjB, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) might offer improved results by reducing toxicity and increasing proper membrane integration .

How might yjjB contribute to Salmonella Dublin pathogenesis mechanisms?

While the specific role of yjjB in Salmonella Dublin pathogenesis has not been directly established in the provided research, several hypotheses can be formulated based on its characteristics as a membrane protein:

  • Membrane integrity and permeability: As a multi-pass membrane protein, yjjB may contribute to maintaining the structural integrity of the bacterial membrane or regulating its permeability, which could affect bacterial survival in hostile host environments .

  • Potential interaction with virulence systems: Salmonella Dublin possesses complex virulence machinery, including T6SSs that function as contractile nanomachines to puncture host cells and deliver virulence factors . Membrane proteins like yjjB could potentially interact with these secretion systems or influence their assembly or function.

  • Involvement in antibiotic resistance: Most Salmonella Dublin strains exhibit multi-drug resistance . Membrane proteins often contribute to efflux mechanisms or membrane permeability alterations that confer antibiotic resistance.

  • Host-pathogen interaction: The localization of yjjB in the bacterial membrane positions it at the interface of host-pathogen interactions, where it could potentially participate in adhesion, invasion, or immune evasion processes.

Experimental approaches to investigate these hypotheses might include gene knockout studies, protein interaction analyses, and comparative pathogenicity assessments between wild-type and yjjB-deficient strains.

What experimental approaches can elucidate the function of yjjB in bacterial membrane dynamics?

To investigate the function of yjjB in bacterial membrane dynamics, researchers can employ several sophisticated experimental approaches:

  • Membrane protein topology mapping: Using techniques such as cysteine scanning mutagenesis or reporter fusion assays to determine the orientation and transmembrane organization of yjjB.

  • Lipid interaction studies: Employing biophysical techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to characterize interactions between purified yjjB and various membrane lipids.

  • Fluorescence microscopy with protein tagging: Using fluorescent protein fusions to visualize the localization and dynamics of yjjB within the bacterial membrane under various environmental conditions.

  • Electrophysiology: If yjjB functions as a channel or transporter, patch-clamp or black lipid membrane techniques could measure ion or solute transport activities.

  • Protein-protein interaction studies: Using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling to identify interaction partners of yjjB within the membrane or other cellular compartments.

  • Comparative genomics and structure prediction: Analyzing the conservation of yjjB across bacterial species and utilizing advanced structural prediction algorithms to generate hypotheses about its function.

What are common challenges in working with recombinant membrane proteins like yjjB?

Working with membrane proteins like yjjB presents several technical challenges that researchers should anticipate and address:

  • Protein solubility issues: Membrane proteins like yjjB are naturally hydrophobic and may aggregate during purification or reconstitution. Researchers should optimize detergent types and concentrations to maintain protein solubility while preserving native structure .

  • Proper folding and orientation: Ensuring that recombinant yjjB maintains its native conformation after expression and purification is critical. Misfolded protein may lack biological activity or form non-specific aggregates.

  • Tag interference: The N-terminal His-tag commonly used for purification may potentially interfere with protein function or interaction studies. Control experiments with tag-cleaved protein may be necessary for functional studies.

  • Freeze-thaw instability: Repeated freeze-thaw cycles can compromise membrane protein integrity. As recommended in the product information, researchers should aliquot reconstituted protein and avoid repeated freezing and thawing .

  • Buffer compatibility: The choice of buffer components, including salt concentration, pH, and additives, can significantly impact membrane protein stability and function. Optimization of these parameters is often necessary for specific experimental applications.

  • Lipid environment requirements: Many membrane proteins require specific lipid environments for proper function. Reconstitution into liposomes with appropriate lipid composition may be necessary for functional studies.

How can researchers address protein degradation during yjjB experiments?

To minimize protein degradation during experiments with recombinant yjjB:

  • Proper storage conditions: Store reconstituted protein at -20°C or -80°C for extended storage periods . For short-term use (up to one week), storage at 4°C may be sufficient to maintain protein integrity .

  • Protease inhibitors: Include a protease inhibitor cocktail in all buffers used for protein handling to prevent degradation by contaminating proteases.

  • Optimal buffer composition: The recommended storage buffer contains Tris/PBS with 6% Trehalose at pH 8.0 . Trehalose acts as a stabilizing agent that protects proteins during freeze-thaw cycles and storage.

  • Glycerol addition: Adding glycerol to a final concentration of 5-50% is recommended for long-term storage, with 50% being the default recommendation . Glycerol acts as a cryoprotectant and helps maintain protein stability during freezing.

  • Temperature management: Keep protein samples on ice during experiments and minimize exposure to room temperature to reduce degradation rates.

  • Sample handling: Minimize unnecessary manipulation of the protein solution, as each handling step introduces potential for degradation. Use low-protein-binding tubes and pipette tips to reduce protein loss during transfers.

  • Quality control: Regularly verify protein integrity using SDS-PAGE or other analytical methods to ensure experimental results are obtained with intact protein.

What controls should be included in experimental studies of yjjB function?

Rigorous experimental design for studying yjjB function should include several types of controls:

  • Negative controls:

    • Heat-denatured yjjB protein to confirm that observed effects require properly folded protein

    • Buffer-only conditions to account for effects of buffer components

    • Unrelated membrane protein of similar size to distinguish yjjB-specific effects from general membrane protein effects

  • Positive controls:

    • Well-characterized membrane proteins with known functions for comparative analysis

    • If studying potential roles in virulence, include known Salmonella virulence factors such as components of T6SS or PagN protein

  • Construct controls:

    • Tag-free yjjB protein to ensure the His-tag is not interfering with function

    • yjjB proteins with point mutations in predicted functional domains to map structure-function relationships

  • Expression system controls:

    • Compare yjjB expressed in different systems (E. coli, yeast, etc.) to ensure proper folding and function

    • Validate expression using antibodies against both the tag and the protein itself

  • Environmental controls:

    • Test function under various pH, temperature, and ionic strength conditions to determine optimal functional parameters

    • If studying membrane interactions, vary lipid composition to assess specificity of interactions

What are potential therapeutic applications targeting yjjB protein?

While therapeutic applications specifically targeting yjjB have not been established in the current literature, several potential approaches could be explored:

  • Antimicrobial drug development: If yjjB proves essential for Salmonella Dublin survival or virulence, it could serve as a target for novel antimicrobials. This approach is particularly valuable given that most S. Dublin strains are multi-drug resistant .

  • Vaccine development: Membrane proteins often make good vaccine candidates. If yjjB is surface-exposed and immunogenic, it could potentially be incorporated into vaccine formulations against Salmonella Dublin. Current approaches already include vaccination of calves and dry cows to control S. Dublin infections .

  • Diagnostic applications: If yjjB expression is specific to Salmonella Dublin or correlates with invasive potential, antibodies or nucleic acid probes targeting this protein could be developed for diagnostic testing, complementing existing diagnostic programs that screen bulk milk for Salmonella Dublin antibodies .

  • Anti-virulence strategies: If yjjB contributes to virulence mechanisms without being essential for bacterial survival, inhibitors could be developed that specifically target virulence without creating selective pressure for resistance development.

How does environmental context affect yjjB expression and function?

The environmental regulation of yjjB expression and function represents an important research direction, particularly considering the ecology of Salmonella Dublin infections:

  • Host environment adaptation: Salmonella Dublin is transmitted from cattle to humans through contaminated milk products . Research could investigate whether yjjB expression changes during transition between bovine and human hosts, potentially contributing to host adaptation.

  • Stress response mechanisms: As Salmonella Dublin must survive various environmental stresses during infection (pH changes, nutrient limitation, immune responses), studies could examine if yjjB plays a role in stress resistance or adaptive responses.

  • Biofilm formation: Many membrane proteins contribute to bacterial biofilm formation, which enhances environmental persistence. Investigation of yjjB's potential role in biofilm development could connect to farm-level control measures focused on environmental hygiene .

  • Temperature regulation: Given that Salmonella must adapt to different temperatures in environmental reservoirs versus mammalian hosts, research could explore temperature-dependent changes in yjjB expression or function.

  • Interaction with the food production environment: Since Salmonella Dublin is associated with dairy products, studies examining yjjB's role in bacterial survival during milk pasteurization or other food safety interventions could have practical applications for prevention strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.