Recombinant Salmonella dublin Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
zntB; SeD_A1678; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella dublin (strain CT_02021853)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGSWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and how does it function in bacterial zinc homeostasis?

ZntB is a zinc transport protein belonging to the CorA metal ion transporter (MIT) superfamily, though functionally distinct from CorA. Current research demonstrates that ZntB mediates zinc uptake stimulated by a pH gradient across the membrane, contradicting earlier hypotheses that it functioned as an efflux transporter . The protein forms a funnel-shaped homopentamer that creates a pore through the membrane, allowing for the regulated transport of zinc ions .

The pentameric structure includes two rings of acidic amino acids at the funnel base that likely strip water molecules from zinc ions during transport . This function is critical for maintaining zinc homeostasis, as zinc is essential for cellular function but highly toxic in excess concentrations .

How does the structure of ZntB compare to other metal transporters in the CorA family?

Despite being part of the same superfamily, ZntB demonstrates significant structural and mechanistic differences from CorA:

FeatureZntBCorA
StructureMaintains symmetric pentameric state even after EDTA treatmentForms asymmetric state upon Mg²⁺ depletion
Transport directionImports zinc (Zn²⁺)Channels magnesium (Mg²⁺)
Driving forceProton gradient dependentConcentration gradient dependent
Ion binding sitesContains multiple chloride ion binding sitesContains divalent cation binding sites
Structural rearrangementMaintains symmetry during transportUndergoes asymmetric collapse during transport

Unlike CorA, which loses its fivefold symmetry in magnesium-free conditions, ZntB maintains its symmetrical pentameric state even after extensive EDTA treatment . This fundamental difference suggests divergent evolutionary adaptations for transporting different metal ions, with ZntB specifically evolved for zinc transport.

What is the mechanism of proton-driven zinc transport by ZntB?

Current research indicates that ZntB functions as a zinc importer rather than an exporter, with transport stimulated by a pH gradient across the membrane . The transport mechanism appears distinct from that of CorA magnesium channels, which operate through a symmetry-collapsed state.

The transport process likely involves:

  • Initial binding of hydrated zinc ions at the entry of the funnel structure

  • Passage through the electrostatically favorable central pore

  • Dehydration of zinc ions by two rings of acidic amino acids at the funnel base

  • Transport of zinc through the membrane domain

  • Release into the cytoplasm driven by the proton gradient

The presence of chloride ions in the structure appears critical, as they neutralize positively-charged amino acids just enough to favor the passage of zinc ions rather than monovalent cations like sodium and potassium . This selective transport mechanism ensures that only zinc can effectively traverse the channel.

How do chloride ions influence the electrostatic properties and transport function of ZntB?

Cryo-EM and crystallographic studies have revealed the presence of multiple chloride ion binding sites in ZntB structures . In the high-resolution structure of the intracellular domain of ZntB from Vibrio parahemolyticus, 25 well-defined chloride ions were observed, with five localized peaks of electron density discovered in each subunit .

Continuum electrostatics calculations suggest that these chloride ions serve several critical functions :

  • They tune the electrostatic properties of the funnel, neutralizing positively-charged amino acids

  • They create an environment that favors divalent zinc ions over monovalent cations

  • They increase the stability of cations along the pore, potentially enhancing transport efficiency

  • They may be important in regulating the opening and closing of the channel

These chloride binding sites are highly conserved within the ZntB family, suggesting their functional importance across different bacterial species . The presence of bound chloride ions significantly increases the stability of cations along the pore, suggesting they play a crucial role in enhancing zinc transport .

What are the optimal methods for expressing and purifying recombinant ZntB for structural and functional studies?

Based on successful structural studies, the following approach is recommended for recombinant ZntB production :

  • Expression system: In vitro E. coli expression system using a vector with an inducible promoter

  • Affinity tag: N-terminal 10xHis-tag for efficient purification

  • Expression region: Full-length protein (residues 1-327) or the intracellular domain, depending on the study goals

  • Purification protocol:

    • Metal affinity chromatography using Ni-NTA resin

    • Size exclusion chromatography to ensure homogeneity

    • Detergent solubilization for membrane domain studies

  • Storage conditions: Store at -20°C in Tris-based buffer with 50% glycerol; for extended storage, conserve at -80°C

  • Working conditions: Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

For crystallography studies of the intracellular domain, removal of the transmembrane domain may improve crystallization properties, as demonstrated in the high-resolution structure of Vibrio parahemolyticus ZntB .

How can zinc transport activity of ZntB be measured in vitro?

Several complementary approaches can be used to assess ZntB transport activity :

  • Isothermal titration calorimetry (ITC):

    • Measures direct binding of zinc to purified ZntB

    • Provides thermodynamic parameters (ΔH, ΔS, Kd)

    • Can determine stoichiometry of binding

  • Radio-ligand uptake assays:

    • ZntB reconstituted into liposomes

    • ⁶⁵Zn as a radiotracer

    • Measure accumulation inside liposomes over time

    • Can be performed with various pH gradients to assess proton-coupling

  • Fluorescent transport assays:

    • ZntB reconstituted into liposomes

    • Zinc-sensitive fluorescent dyes (FluoZin-1, FluoZin-3)

    • Real-time measurement of transport kinetics

    • Can determine initial transport rates and substrate specificity

  • Patch-clamp electrophysiology:

    • Direct measurement of ion currents

    • Can resolve transport events at the single-molecule level

    • Allows manipulation of membrane potential and ion gradients

When reconstituting ZntB into liposomes, it's important to control the protein orientation to ensure the intracellular domain faces outward for accurate assessment of transport properties .

What structural biology techniques are most effective for studying ZntB conformational states?

Several complementary structural biology techniques have proven valuable for elucidating ZntB structure and function :

  • X-ray crystallography:

    • Provided high-resolution (1.90 Å) structure of the intracellular domain

    • Revealed chloride ion binding sites

    • Limited to stable conformations amenable to crystallization

  • Cryo-electron microscopy (cryo-EM):

    • Resolved full-length ZntB structure

    • Can capture different conformational states

    • Works well for membrane proteins in detergent or nanodiscs

    • Doesn't require crystallization

  • Anomalous diffraction:

    • Used to identify bound ions in the structure

    • Distinguished chloride ions from potential zinc binding sites

    • Essential for accurate ion assignment in the structure

  • Molecular dynamics simulations:

    • Model conformational changes during transport

    • Investigate ion permeation pathways

    • Study effects of mutations on structure and function

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Measure distances between spin-labeled residues

    • Track conformational changes in solution

    • Works well for dynamic systems

The combination of these approaches provides a comprehensive understanding of ZntB structure and conformational dynamics during the transport cycle .

What are the current gaps in knowledge regarding ZntB and future research priorities?

Despite significant progress, several knowledge gaps remain in our understanding of ZntB :

  • Conformational changes during transport:

    • How does ZntB structure change during the transport cycle?

    • What triggers these conformational changes?

    • How is transport coupled to the proton gradient?

  • Zinc binding sites:

    • Precise location of zinc binding sites in the full structure

    • Coordination chemistry of zinc within the transporter

    • Binding affinity and selectivity mechanisms

  • Regulation of ZntB expression:

    • Transcriptional and post-translational regulation

    • Environmental signals controlling expression

    • Cross-talk with other zinc homeostasis systems

  • Role in pathogenesis:

    • Contribution to Salmonella dublin virulence

    • Potential as an antimicrobial target

    • Function during different stages of infection

Future research priorities should include:

  • Capturing additional conformational states of ZntB using cryo-EM

  • Detailed characterization of proton coupling mechanism

  • Investigation of ZntB regulation in response to zinc availability

  • Assessment of ZntB's contribution to Salmonella dublin pathogenesis

  • Exploration of ZntB as a potential therapeutic target for Salmonella infections

Understanding these aspects will provide a comprehensive picture of ZntB function and its role in bacterial physiology and pathogenesis.

How can researchers address the technical challenges in studying ZntB?

Studying membrane transporters like ZntB presents several technical challenges that can be addressed through methodological innovations:

  • Protein stability issues:

    • Optimize buffer conditions (pH, salt, additives)

    • Use stabilizing mutations or antibody fragments

    • Employ nanodiscs or amphipols for membrane domain stability

  • Functional reconstitution:

    • Control protein orientation in liposomes

    • Minimize protein aggregation during reconstitution

    • Establish reliable activity assays with appropriate controls

  • Capturing transient states:

    • Use inhibitors or substrate analogs to trap intermediate states

    • Employ time-resolved structural methods

    • Develop computational models of the transport cycle

  • Distinguishing transport from binding:

    • Combine binding assays with transport measurements

    • Use zinc-specific fluorescent probes

    • Develop electrophysiological approaches for direct transport measurement

By addressing these challenges, researchers can gain deeper insights into the structure-function relationships of ZntB and its role in zinc homeostasis in Salmonella dublin.

What are the key considerations for researchers new to ZntB studies?

For researchers beginning work on ZntB, consider the following recommendations:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.