Recombinant Salmonella enteritidis PT4 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The ubiA enzyme (UniProt ID: B5QZ59) is encoded by the ubiA gene (SEN4003) in Salmonella enteritidis PT4 . It belongs to the UbiA superfamily of intramembrane prenyltransferases, which are conserved across bacteria, archaea, and eukaryotes . Its primary role is in synthesizing ubiquinones (CoQ), essential for electron transport in cellular respiration and antioxidant defense .

Key Features

AttributeValueSource
Gene NameubiA (SEN4003)
Protein LengthFull-length (1–290 amino acids)
Uniprot IDB5QZ59
Enzyme ClassEC 2.5.1.- (4-hydroxybenzoate octaprenyltransferase)
Expression SystemE. coli (N-terminal His-tagged)

Crystallographic Insights

Structural studies on archaeal UbiA homologs reveal a transmembrane architecture with nine helices and a central cavity housing the active site . The enzyme’s lateral portal facilitates interactions with lipid bilayers, enabling IPP binding and product release directly into membranes .

Active Site Residues
Critical residues include:

  • Asp-rich motifs: Chelate Mg²⁺ ions for catalysis .

  • Arg60 (EcUbiA): Binds PHB’s carboxyl group (Kₘ increases tenfold in Arg60Ala mutants) .

  • Asn67/Asp184: Stabilize the carbocation intermediate during IPP cleavage .

Catalytic Mechanism

  1. Substrate Binding: IPP binds via pyrophosphate interactions; PHB positions at the meta-site .

  2. Cleavage: IPP’s pyrophosphate is released, forming a carbocation intermediate .

  3. Prenylation: Carbocation attacks PHB’s aromatic ring, generating a C-C bond .

Genomic Context

  • Part of the core genome in S. enteritidis PT4, highlighting its evolutionary conservation .

  • Absent in host-adapted strains like S. Gallinarum, underscoring its role in host-promiscuous pathogenesis .

Enzyme Promiscuity

UbiA accepts short-chain IPPs (e.g., geranylpyrophosphate) in vitro, enabling divergent quinone synthesis . This flexibility is exploited in metabolic engineering studies.

Disease Links

Mutations in UbiA superfamily members (e.g., human COQ2, UBIAD1) correlate with:

  • Cardiovascular disorders: Impaired vascular homeostasis .

  • Neurodegeneration: Parkinson’s disease-linked mitochondrial dysfunction .

  • Antibiotic Resistance: Acquisition of plasmids (e.g., blaTEM in PT4a variants) .

Biosynthesis Studies

  • Ubiquinone Production: Used to study CoQ biosynthetic pathways and membrane-targeted enzymatic reactions .

  • Chemoenzymatic Synthesis: Engineered for producing aromatic prenyl derivatives .

Diagnostic Tools

  • ELISA Kits: Recombinant ubiA serves as an immunogen for detecting S. enteritidis PT4-specific antibodies .

  • Outbreak Tracking: Whole-genome sequencing discriminates PT4 strains in foodborne outbreaks .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiA; SEN4003; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the membrane-bound intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: set:SEN4003

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella enteritidis?

4-hydroxybenzoate octaprenyltransferase (ubiA) is a membrane-bound enzyme that catalyzes a critical step in ubiquinone biosynthesis. Specifically, it attaches 4-hydroxybenzoate to the membrane-bound octaprenyl diphosphate, initiating the formation of the ubiquinone (coenzyme Q) precursor . This enzyme belongs to the prenyltransferase enzyme family (EC 2.5.1.-) and plays an essential role in electron transport chain function. UbiA's activity is fundamental to bacterial energy metabolism as ubiquinone serves as a mobile electron carrier in the respiratory chain, making it critical for cellular respiration and ATP production in Salmonella enteritidis PT4.

How does ubiA contribute to Salmonella virulence and pathogenicity mechanisms?

The ubiA enzyme indirectly contributes to Salmonella virulence through its essential role in energy metabolism. While not a classical virulence factor itself, ubiA's contribution to ubiquinone biosynthesis supports the energy requirements necessary for various virulence mechanisms. Research indicates that metabolic pathways influence bacterial virulence expression, as seen with aroA-deficient strains showing altered pathogenicity . The energy provided through properly functioning electron transport chains, which depend on ubiquinone, enables Salmonella to adapt to host environments, resist host defenses, and express virulence factors. Loss of functional ubiA would likely compromise bacterial fitness within host environments due to impaired energy production, potentially affecting invasion capacity, intracellular survival, and replication rates.

How does the catalytic mechanism of ubiA compare to other prenyltransferases in the ubiquinone biosynthetic pathway?

The catalytic mechanism of ubiA involves several defined steps that differentiate it from other prenyltransferases. First, the enzyme coordinates a divalent metal ion (typically Mg²⁺) to facilitate the reaction. The metal ion helps position the pyrophosphate group of the prenyl donor (octaprenyl diphosphate) for nucleophilic attack. Unlike soluble prenyltransferases, ubiA must accommodate both a hydrophilic substrate (4-hydroxybenzoate) and a highly hydrophobic prenyl donor within the membrane environment .

The reaction proceeds through an electrophilic aromatic substitution mechanism where:

  • The phenolic oxygen of 4-hydroxybenzoate acts as a nucleophile

  • The divalent metal ion-coordinated pyrophosphate serves as a leaving group

  • The C-O bond formation occurs para to the carboxylate group

This mechanism differs from other prenyltransferases in the pathway in substrate specificity and the regiospecificity of prenylation. For instance, while ubiA catalyzes C-prenylation on an aromatic ring, other prenyltransferases may catalyze O-prenylation or prenylation at different positions . The membrane localization of ubiA also creates unique constraints on substrate binding and product release compared to cytosolic enzymes in the pathway.

What are the methodological approaches to studying ubiA activity in vitro?

Studying ubiA activity in vitro requires specialized techniques due to its membrane-bound nature. A comprehensive methodological approach includes:

Enzymatic Activity Assay:

  • Radiolabeled substrate method: Using ¹⁴C-labeled 4-hydroxybenzoate to track product formation

  • HPLC-based detection: Monitoring the disappearance of 4-hydroxybenzoate and appearance of prenylated products

  • Coupled enzyme assays: Linking ubiA activity to detectable enzymatic reactions

Reconstitution Systems:

  • Liposome reconstitution: Purified ubiA incorporated into artificial lipid bilayers

  • Nanodiscs: Embedding ubiA in membrane mimetic systems for improved stability

  • Detergent micelles: Solubilizing ubiA in mild detergents that maintain activity

Structural Analysis Approaches:

  • Site-directed mutagenesis to identify critical residues

  • Limited proteolysis to define domain boundaries

  • Cross-linking studies to determine substrate binding sites

A typical activity assay protocol involves preparing membrane fractions containing ubiA, incubating with substrates (4-hydroxybenzoate and octaprenyl diphosphate) in the presence of Mg²⁺, and analyzing reaction products using chromatographic techniques . Researchers must carefully optimize detergent types and concentrations when working with solubilized enzyme to maintain native activity.

How do aroA mutations in Salmonella affect ubiA expression and ubiquinone biosynthesis?

The relationship between aroA mutations and ubiA expression represents a complex metabolic interaction. AroA (5-enolpyruvylshikimate-3-phosphate synthase) functions in the shikimate pathway, which is upstream of 4-hydroxybenzoate synthesis, the substrate for ubiA. Research has revealed that aroA-deficient Salmonella strains demonstrate pleiotropic effects on cellular physiology and metabolism .

The effects include:

  • Altered metabolic flux through connected pathways, potentially affecting 4-hydroxybenzoate availability

  • Transcriptomic changes that can indirectly influence ubiA expression

  • Physiological adaptations that may compensate for metabolic deficiencies

Studies have shown that aroA mutants exhibit "dramatically altered gene expression, metabolism, and cellular physiology" . These changes could affect ubiquinone biosynthesis in several ways:

  • Reduced substrate availability due to shikimate pathway disruption

  • Compensatory upregulation of ubiA to maximize utilization of limited 4-hydroxybenzoate

  • Altered membrane composition that might affect ubiA functionality

These metabolic disturbances contribute to the observed changes in virulence and immunogenicity of aroA-deficient Salmonella strains . The complete understanding of these metabolic interactions requires metabolomic profiling and flux analysis of the aroA mutants compared to wild-type strains.

What are the optimal conditions for expressing and purifying recombinant Salmonella enteritidis PT4 ubiA?

The expression and purification of recombinant ubiA from Salmonella enteritidis PT4 requires careful optimization due to its membrane-bound nature. Based on established protocols for similar membrane proteins, the following methodology is recommended:

Expression System Selection:

  • E. coli C41(DE3) or C43(DE3) strains are preferred for membrane protein expression

  • pET-based vectors with an inducible T7 promoter system

  • Addition of C-terminal or N-terminal affinity tags (His₆, FLAG, or Strep-tag II)

Expression Conditions:

  • Lower induction temperature (16-20°C) to reduce inclusion body formation

  • Reduced IPTG concentration (0.1-0.5 mM) for slower expression

  • Extended expression time (16-24 hours) for proper membrane insertion

Membrane Preparation Protocol:

  • Cell disruption by sonication or French press in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

  • Low-speed centrifugation (10,000 × g, 20 min) to remove cell debris

  • Ultracentrifugation (100,000 × g, 1 hour) to collect membrane fraction

  • Membrane solubilization using detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG)

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

  • Size exclusion chromatography for further purification and detergent exchange

  • Optional ion exchange chromatography for higher purity

The purified protein should be stored in a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, and 0.03% DDM at -80°C . For long-term storage, the addition of 50% glycerol helps maintain protein stability as indicated in the storage recommendations for similar proteins .

How can researchers assess the effects of ubiA mutations on Salmonella virulence and metabolism?

Assessing the effects of ubiA mutations on Salmonella virulence and metabolism requires a multi-faceted approach:

In Vitro Approaches:

  • Growth Curve Analysis:

    • Measure growth rates in different media types

    • Compare aerobic vs. anaerobic growth conditions

    • Assess growth in nutrient-limited conditions

  • Metabolic Profiling:

    • Quantify ubiquinone levels using HPLC or LC-MS

    • Measure membrane potential using fluorescent probes

    • Analyze cellular ATP content and NADH/NAD⁺ ratios

  • Stress Response Assays:

    • Oxidative stress resistance (H₂O₂, paraquat)

    • pH tolerance

    • Antibiotic susceptibility

In Vivo Approaches:

  • Infection Models:

    • Murine infection model (similar to aroA studies)

    • Cell culture invasion assays

    • Competitive index assays (wild-type vs. mutant)

  • Virulence Assessment:

    • LD₅₀ determination

    • Bacterial burden in tissues

    • Histopathological examination

    • Cytokine profiling (TNF-α, IL-6, etc.)

  • Gene Expression Analysis:

    • RNA-Seq or microarray of infected tissues

    • qRT-PCR of virulence genes during infection

    • Promoter-reporter fusions to monitor gene expression in vivo

The approach should be comparative, analyzing ubiA mutants alongside wild-type and other well-characterized mutants (e.g., aroA mutants) . This comparative analysis would help determine whether ubiA mutations result in phenotypes similar to other attenuated strains or create distinct physiological and virulence profiles.

What techniques can be used to study protein-protein interactions involving ubiA in the ubiquinone biosynthetic pathway?

Studying protein-protein interactions (PPIs) involving membrane proteins like ubiA requires specialized techniques that accommodate their hydrophobic nature and native membrane environment:

In Vitro Techniques:

  • Co-immunoprecipitation with Membrane Solubilization:

    • Solubilize membranes with mild detergents (DDM, digitonin)

    • Use antibodies against ubiA or epitope tags

    • Identify interacting partners by mass spectrometry

  • Proximity Labeling Methods:

    • BioID: Fusion of biotin ligase to ubiA to biotinylate proximal proteins

    • APEX2: Peroxidase-based proximity labeling

    • Analysis of biotinylated proteins by streptavidin pulldown and mass spectrometry

  • Membrane-Based Two-Hybrid Systems:

    • MYTH (Membrane Yeast Two-Hybrid)

    • Split-ubiquitin assays

    • Bacterial two-hybrid systems adapted for membrane proteins

In Vivo Approaches:

  • Förster Resonance Energy Transfer (FRET):

    • Fusion of fluorescent proteins to ubiA and potential partners

    • Live-cell imaging to detect interactions

    • FLIM-FRET for quantitative interaction analysis

  • Cross-linking Coupled with Mass Spectrometry:

    • In vivo cross-linking with membrane-permeable cross-linkers

    • Purification of cross-linked complexes

    • Identification of cross-linked peptides by MS/MS

  • Genetic Interaction Mapping:

    • Synthetic genetic array analysis

    • Double knockout/knockdown studies

    • Suppressor screens to identify functional relationships

These techniques can reveal whether ubiA functions as part of a larger complex in the ubiquinone biosynthetic pathway or interacts transiently with other enzymes in the pathway. The data can be compiled into interaction networks to visualize the protein's role within the larger context of cellular metabolism and identify potential regulatory interactions that might affect enzyme activity.

What are the current challenges in determining the three-dimensional structure of ubiA?

Determining the three-dimensional structure of membrane proteins like ubiA presents significant challenges that have limited structural studies of this enzyme. Current obstacles include:

Technical Challenges:

  • Protein Expression and Purification Difficulties:

    • Low expression yields compared to soluble proteins

    • Maintaining stability during extraction from membranes

    • Preserving native conformation in detergent micelles

  • Crystallization Barriers:

    • Finding detergents compatible with crystallization

    • Limited polar surface area for crystal contacts

    • Conformational heterogeneity

  • Data Collection and Processing Complexities:

    • Weak diffraction from membrane protein crystals

    • High solvent content leading to radiation damage

    • Phase determination challenges

Methodological Approaches to Address These Challenges:

  • Lipidic Cubic Phase (LCP) Crystallization:

    • Embedding protein in lipid bilayer-mimetic environment

    • Facilitates crystal formation in a native-like membrane environment

    • Has proven successful for several membrane prenyltransferases

  • Cryo-Electron Microscopy (Cryo-EM):

    • Avoids need for crystallization

    • Recent advances in resolution make it viable for proteins >100 kDa

    • May require reconstitution into nanodiscs or liposomes

  • Hybrid Approaches:

    • Integration of homology modeling with sparse experimental data

    • Cross-linking mass spectrometry to provide distance constraints

    • Molecular dynamics simulations in membrane environments

Understanding the structure-function relationship of ubiA would provide critical insights into its catalytic mechanism and substrate specificity, potentially enabling structure-based drug design targeting this enzyme .

How can ubiA and the ubiquinone pathway be targeted for antimicrobial development?

The essential nature of ubiquinone biosynthesis for bacterial respiration makes ubiA an attractive target for antimicrobial development. Strategic approaches include:

Target Validation and Drug Discovery Approaches:

  • Structure-Based Drug Design:

    • Developing inhibitors that compete with 4-hydroxybenzoate or prenyl diphosphate

    • Designing allosteric inhibitors that disrupt enzyme dynamics

    • Creating transition-state analogs based on reaction mechanism

  • High-Throughput Screening:

    • Enzymatic assays adapted to plate-based formats

    • Whole-cell phenotypic screens for respiratory inhibition

    • Fragment-based screening to identify starting scaffolds

  • Natural Product Mining:

    • Identification of natural products that target prenyl transferases

    • Structural optimization of hits to improve potency and selectivity

    • Combination with traditional antibiotics for synergistic effects

Potential Advantages as an Antimicrobial Target:

  • Essentiality: Ubiquinone is crucial for aerobic respiration in many pathogens

  • Selectivity: Structural differences between bacterial and human enzymes allow for selective targeting

  • Resistance Barrier: Multiple enzymes would need to be mutated for resistance to develop

Challenges in Drug Development:

  • Membrane Permeability: Compounds must cross both outer and inner membranes in Gram-negative bacteria

  • Metabolic Adaptation: Some bacteria can switch to alternative electron acceptors

  • Structural Similarity: Care needed to avoid cross-reactivity with human prenyltransferases

This approach represents a promising avenue for novel antimicrobial development, particularly against multidrug-resistant Gram-negative pathogens like Salmonella that rely heavily on respiratory metabolism during infection .

What research gaps exist in understanding the regulation of ubiA expression and activity in Salmonella?

Several significant research gaps exist in our understanding of ubiA regulation and activity in Salmonella enteritidis, presenting opportunities for future investigation:

Transcriptional and Translational Regulation:

  • Promoter Architecture and Transcription Factors:

    • Identity of transcription factors controlling ubiA expression

    • Environmental signals that modulate transcription

    • Identification of promoter elements and regulatory regions

  • Post-Transcriptional Control:

    • Role of small RNAs in regulating ubiA mRNA stability

    • Translational efficiency under different growth conditions

    • Potential riboswitches or other regulatory RNA elements

Post-Translational Regulation:

  • Enzyme Modification:

    • Phosphorylation, acetylation, or other modifications affecting activity

    • Protein stability and turnover rates

    • Interactions with regulatory proteins

  • Metabolic Feedback:

    • Effects of ubiquinone levels on enzyme activity

    • Cross-regulation with other metabolic pathways

    • Substrate availability as a regulatory mechanism

Environmental Adaptation:

  • Response to Host Environment:

    • Regulation during infection and intracellular survival

    • Adaptation to host-derived stresses

    • Changes in expression during different infection stages

  • Interaction with Other Mutational Backgrounds:

    • Mechanisms behind observed phenotypes in aroA mutants

    • Compensatory pathways activated in ubiA-deficient strains

    • Genetic interactions with virulence regulatory networks

These research gaps highlight the need for comprehensive studies integrating transcriptomics, proteomics, and metabolomics approaches to fully understand how Salmonella regulates this critical enzyme in different environments, particularly during host infection. Understanding these regulatory mechanisms could reveal new strategies for antimicrobial development or vaccine strain engineering.

How can recombinant ubiA be utilized in metabolic engineering applications?

Recombinant ubiA presents several valuable applications in metabolic engineering initiatives, particularly for enhancing production of isoprenoid-derived compounds and improving bacterial production systems:

Enhanced Ubiquinone Production:

  • Overexpression Strategies:

    • Co-expression with rate-limiting enzymes in the pathway

    • Promoter engineering to optimize expression levels

    • Codon optimization for the production host

  • Pathway Engineering:

    • Balancing precursor supply (4-hydroxybenzoate and octaprenyl diphosphate)

    • Removing feedback inhibition through enzyme engineering

    • Integration with central carbon metabolism optimization

Production of Novel Prenylated Compounds:

  • Enzyme Engineering for Altered Substrate Specificity:

    • Rational design based on structural information

    • Directed evolution for accepting non-native substrates

    • Creation of chimeric enzymes with altered regiospecificity

  • Biosynthetic Pathway Design:

    • Integration of ubiA variants into heterologous pathways

    • Production of novel prenylated aromatics with pharmaceutical potential

    • Engineering artificial metabolic modules incorporating ubiA

Practical Implementation Table:

ApplicationEngineering ApproachExpected OutcomeChallenges
Ubiquinone productionOverexpression with balanced precursor supply3-5 fold increase in ubiquinone yieldMembrane space limitations; toxicity
Novel prenylated pharmaceuticalsSubstrate specificity engineeringProduction of non-natural prenylated aromaticsLow catalytic efficiency with non-native substrates
Bacterial fitness enhancementOptimized expression under stressImproved survival in industrial conditionsMetabolic burden; growth rate trade-offs
Aromatic polyketide diversificationPathway integration with polyketide synthasesNovel hybrid natural productsEnzyme compatibility; precursor competition

These applications demonstrate how recombinant ubiA can serve as a valuable biocatalyst in metabolic engineering efforts, particularly for the production of high-value isoprenoid derivatives and novel bioactive compounds.

What methods are available for studying the kinetics of the ubiA-catalyzed reaction?

Studying the enzyme kinetics of ubiA presents unique challenges due to its membrane-bound nature and the hydrophobicity of one of its substrates. Several methodological approaches have been developed to overcome these challenges:

Direct Activity Measurement Techniques:

  • Radiolabeled Substrate Approach:

    • Using ¹⁴C-labeled 4-hydroxybenzoate

    • Time-course sampling and liquid scintillation counting

    • Separation of products by thin-layer chromatography

  • HPLC-Based Methods:

    • Reverse-phase HPLC separation of reaction products

    • UV detection at 254 nm for aromatic compounds

    • Internal standard addition for quantification

  • Coupled Enzyme Assays:

    • Linking reaction to pyrophosphate release

    • Enzymatic conversion of pyrophosphate to detectable products

    • Continuous spectrophotometric monitoring

Kinetic Parameter Determination:

  • Initial Velocity Measurements:

    • Varying concentrations of 4-hydroxybenzoate (1-500 μM range)

    • Varying concentrations of octaprenyl diphosphate (1-100 μM range)

    • Determination of Km, Vmax, and kcat values

  • Inhibition Studies:

    • Competitive inhibitors to determine binding mechanisms

    • Product inhibition patterns

    • Dead-end inhibitor analysis

  • pH and Temperature Dependence:

    • Activity profiling across pH range 6.0-9.0

    • Temperature optima and stability determination

    • Activation energy calculation from Arrhenius plots

Data Analysis Methods:

  • Michaelis-Menten Kinetics:

    • Non-linear regression for parameter fitting

    • Lineweaver-Burk and Eadie-Hofstee transformations for visualization

    • Global fitting approaches for complex mechanisms

  • Advanced Kinetic Models:

    • Ordered Bi Bi mechanism evaluation

    • Random Bi Bi mechanism testing

    • Ping Pong mechanism assessment

These methodologies enable comprehensive characterization of ubiA enzymatic parameters, providing insights into its catalytic mechanism and potential for engineering applications in metabolic pathways .

How can researchers investigate the role of ubiA in bacterial adaptation to different environmental conditions?

Investigating ubiA's role in bacterial adaptation requires integrating multiple experimental approaches to understand how this enzyme responds to changing environments:

Transcriptional Regulation Studies:

  • qRT-PCR Analysis:

    • Measure ubiA expression under various conditions:

      • Oxygen limitation

      • Nutrient restriction

      • Host-mimicking environments

      • Different growth phases

    • Compare with other genes in the ubiquinone pathway

  • Promoter-Reporter Fusion Systems:

    • GFP or luciferase fused to ubiA promoter

    • Real-time monitoring of expression in changing conditions

    • Single-cell analysis to detect population heterogeneity

  • Chromatin Immunoprecipitation (ChIP):

    • Identify transcription factors binding to ubiA promoter

    • Map regulatory sites under different conditions

    • Connect to global regulatory networks

Physiological Response Assessment:

  • Comparative Growth Studies:

    • ubiA mutant vs. wild-type across environmental conditions

    • Complementation studies to confirm phenotypes

    • Competition assays for fitness determination

  • Metabolic Profiling:

    • Measure ubiquinone levels in different environments

    • Assess changes in membrane composition

    • Metabolomic analysis to identify adaptive shifts

  • Stress Response Analysis:

    • Survival under oxidative, osmotic, and pH stress

    • Resistance to host antimicrobial peptides

    • Antibiotic tolerance profiles

In Vivo Relevance:

  • Animal Infection Models:

    • Tissue-specific expression analysis during infection

    • Recovery of bacteria from different host niches

    • Comparison with aroA mutants for understanding metabolic adaptation

  • Ex Vivo Systems:

    • Macrophage survival assays

    • Intestinal epithelial cell invasion

    • Serum resistance testing

These approaches would provide a comprehensive understanding of how ubiA expression and activity are modulated in response to environmental conditions, revealing its role in Salmonella adaptation to diverse environments, particularly during host infection. The connection to virulence observed in aroA mutants suggests complex metabolic adaptations involving these pathways that warrant further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.