Recombinant Salmonella enteritidis PT4 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase in Salmonella enteritidis PT4

Salmonella enteritidis PT4 is a well-characterized pathogen that has been thoroughly studied due to its clinical significance and broad host range capabilities. Complete genome sequencing of S. enteritidis PT4 isolate P125109 has revealed extensive similarities with other Salmonella serovars, sharing over 90% of coding sequences with S. Typhimurium LT2 . The ATP synthase complex represents one of the essential cellular machinery components conserved across bacterial species, including various Salmonella strains.

ATP synthase is a multi-subunit enzyme complex responsible for ATP production through oxidative phosphorylation. The complex consists of two main components: the membrane-embedded F₀ sector and the cytoplasmic F₁ sector. The subunit a (atpB) is a critical component of the F₀ sector, which forms the transmembrane proton channel necessary for converting the proton motive force into mechanical energy that drives ATP synthesis.

Protein Structure and Properties

The ATP synthase subunit a (atpB) in S. enteritidis PT4 is a hydrophobic transmembrane protein that forms part of the proton channel in the F₀ sector. Based on comparative analysis with related proteins such as those found in Salmonella arizonae, the atpB protein is expected to contain multiple transmembrane helices that span the bacterial membrane . The protein likely shares significant structural similarities with other F₀ sector subunit a proteins across bacterial species.

Amino Acid Composition and Sequence Analysis

While the exact amino acid sequence of S. enteritidis PT4 atpB is not explicitly provided in the search results, we can infer from related proteins that it likely contains a high proportion of hydrophobic residues, consistent with its membrane-embedded nature. Sequence conservation analysis would be expected to show higher conservation in regions essential for proton translocation and interaction with other ATP synthase subunits.

Physicochemical Properties

Drawing from data available for other recombinant ATP synthase subunits from Salmonella species, the recombinant atpB protein would likely demonstrate the following physicochemical properties:

PropertyCharacteristic
Molecular WeightApproximately 25-30 kDa
HydrophobicityHigh (membrane protein)
StabilityTemperature sensitive
SolubilityLow in aqueous solutions without detergents
Optimal pH6.5-7.5 (physiological)
Storage Conditions-20°C/-80°C with 50% glycerol recommended

Role in Proton Translocation

The subunit a (atpB) of ATP synthase plays a crucial role in proton translocation across the bacterial membrane. It forms a proton channel in conjunction with the c-ring, allowing protons to flow down their electrochemical gradient. This proton flow is essential for driving the rotary motion of the ATP synthase complex, which couples the energy of proton movement to ATP synthesis.

Interaction with Other ATP Synthase Subunits

The atpB protein interacts primarily with the c-ring subunits (atpE) and subunit b of the F₀ sector. These interactions are critical for maintaining the structural integrity of the proton channel and for ensuring efficient energy coupling between proton translocation and ATP synthesis. The essential nature of these interactions is reflected in the high conservation of interfacial residues across bacterial species.

Energy Conservation Mechanism

Research on type-III protein secretion systems in Salmonella has revealed interesting insights into the relationship between ATP hydrolysis and proton motive force in bacterial energy metabolism. Studies have shown that increased proton motive force can bypass the requirement for ATPase activity in certain secretion processes . This suggests a complex interplay between ATP synthase activity and cellular energy states, with potential implications for understanding the role of atpB in energy conservation.

Expression Systems and Methodologies

The production of recombinant ATP synthase subunit a presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. Based on protocols used for similar proteins, expression systems such as baculovirus have been utilized successfully for production of ATP synthase subunits from Salmonella . E. coli-based expression systems with specialized vectors designed for membrane protein expression represent another viable approach.

Purification Strategies

Purification of recombinant atpB typically involves:

  1. Cell lysis under conditions that preserve membrane protein structure

  2. Membrane fraction isolation

  3. Solubilization using appropriate detergents

  4. Affinity chromatography utilizing engineered tags

  5. Size exclusion chromatography for final purification

The resulting protein product typically achieves a purity of >85% as determined by SDS-PAGE .

Functional Characterization

Researchers employ recombinant atpB in functional assays to investigate:

  • Proton translocation efficiency

  • Effects of mutations on ATP synthesis

  • Interaction dynamics with other ATP synthase subunits

  • Inhibitor binding and mechanism studies

These studies contribute significantly to our understanding of bioenergetics in bacterial systems.

Antibody Production and Immunological Studies

Recombinant ATP synthase subunits from S. enteritidis PT4, including atpB, serve as antigens for antibody production. These antibodies facilitate immunolocalization studies, protein quantification, and investigation of protein-protein interactions within the ATP synthase complex.

Comparative Analysis with Other ATP Synthase Subunits

Comparative genomic analyses of Salmonella Enteritidis PT4 with other Salmonella serovars reveal high conservation of core metabolic machinery, including ATP synthase components . This conservation underscores the essential nature of these proteins and their importance in bacterial viability. The atpB gene, as part of this conserved machinery, likely exhibits similar patterns of evolutionary conservation.

Role in Pathogenesis

The potential relationship between ATP synthesis efficiency and virulence in S. enteritidis PT4 represents an intriguing area for further investigation. Research on how energy metabolism affects pathogen fitness during infection could yield valuable insights for antimicrobial development.

Drug Target Potential

The essential nature of ATP synthase for bacterial viability makes atpB a potential target for antimicrobial development. Structure-based drug design approaches utilizing recombinant atpB could facilitate the discovery of novel inhibitors specific to bacterial ATP synthase.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; SEN3685; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
atpB
Target Protein Sequence
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links

KEGG: set:SEN3685

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does atpB interact with other ATP synthase subunits?

AtpB (subunit a) forms critical interactions with several other ATP synthase components:

  • c-ring interaction: AtpB provides the structural interface through which protons pass to the c-ring. This interaction is essential for establishing the proton-motive force that drives ATP synthesis .

  • Stator arm connection: AtpB interacts with the peripheral stalk components, helping to anchor the static parts of the complex while allowing rotation of the c-ring and central stalk components (γ, δ, and ε) .

  • Stabilization role: AtpB, together with subunit A6L, plays a crucial role in stabilizing the holocomplex V structure .

  • Dimer formation: AtpB contributes to the formation of ATP synthase dimers and higher oligomers, which are essential for optimal enzyme function and membrane curvature regulation .

Research using immunoprecipitation techniques has demonstrated that subunit a is essential for proper ATP synthase assembly, with its absence leading to the formation of a smaller 550 kDa complex instead of the complete 597 kDa holocomplex V .

What is the evolutionary significance of atpB across bacterial species?

ATP synthase is a highly conserved enzyme across all domains of life, with the F-type ATP synthases found in bacteria, mitochondria, and chloroplasts. The structural and functional conservation of atpB reflects its fundamental role in cellular bioenergetics.

In bacterial systems, F-type ATP synthases like that in Salmonella enteritidis primarily function in ATP synthesis, utilizing the proton gradient established across the plasma membrane . This contrasts with some bacterial species that can run the enzyme in reverse to establish a proton gradient at the expense of ATP.

Comparative studies can be conducted using antibodies such as anti-AtpB (AS08 085), which has demonstrated cross-reactivity with F-type ATP synthases across plant, green algal, animal, and bacterial species, indicating structural conservation of key epitopes .

What expression systems are optimal for recombinant Salmonella atpB production?

Based on current research practices, E. coli expression systems are commonly used for the recombinant production of Salmonella ATP synthase components. When selecting an expression system, researchers should consider:

  • Expression host: E. coli is the predominant choice for recombinant Salmonella protein expression due to genetic similarity and established protocols .

  • Vector selection: Vectors containing appropriate promoters (T7, tac, or arabinose-inducible promoters) along with fusion tags facilitate controlled expression and subsequent purification.

  • Induction conditions: Optimizing temperature, inducer concentration, and induction time is critical for membrane protein expression. Lower temperatures (16-25°C) often improve proper folding of membrane proteins like atpB.

For atpB specifically, expression in E. coli using a controllable promoter system with a purification tag (such as His-tag) has been successfully implemented for related ATP synthase components . Storage in a Tris-based buffer with 50% glycerol optimizes protein stability .

What purification challenges are specific to recombinant atpB?

As a membrane protein with multiple transmembrane domains, atpB presents several purification challenges:

  • Solubilization: Effective solubilization requires careful selection of detergents. Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are often suitable for extracting membrane proteins while maintaining native conformation.

  • Maintaining stability: AtpB tends to aggregate when removed from its membrane environment. Using stabilizing agents and optimized buffer conditions (including glycerol as a stabilizer) is essential .

  • Purification strategy: Affinity chromatography using fusion tags (His-tag commonly employed) followed by size exclusion chromatography has proven effective for similar membrane proteins.

  • Protein quality assessment: Assessing the quality of purified atpB should include SDS-PAGE, Western blotting, and functional assays to verify proper folding and activity.

Protocols should incorporate measures to prevent repeated freeze-thaw cycles, with recommendations to store working aliquots at 4°C for up to one week .

How can researchers assess the proton channel function of recombinant atpB?

Several methodologies can be employed to evaluate the proton-channeling function of recombinant atpB:

  • Reconstitution in proteoliposomes: Incorporate purified atpB into artificial liposomes along with other necessary ATP synthase components. This system allows for measurement of proton translocation using pH-sensitive dyes or electrodes.

  • Patch-clamp electrophysiology: This technique enables direct measurement of proton currents through incorporated atpB channels in membrane patches or artificial bilayers.

  • ATP synthesis assays: When incorporated with other ATP synthase components, functional atpB should support ATP synthesis in the presence of a proton gradient. This can be measured using luciferin/luciferase-based ATP detection systems.

  • Proton gradient collapse assays: Functional atpB should facilitate the dissipation of an artificially imposed proton gradient, which can be monitored using pH-sensitive fluorescent probes.

These functional analyses provide critical insights into whether the recombinant protein retains its native activity following expression and purification.

What techniques are available for studying atpB-protein interactions?

Understanding the interaction partners of atpB is crucial for characterizing its role within the ATP synthase complex and potentially in other cellular processes:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpB to pull down interacting proteins, followed by mass spectrometry identification. For example, research has demonstrated interactions between MgtC and AtpB in Salmonella using this approach .

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking can capture transient interactions between atpB and other proteins.

  • Blue Native PAGE (BN-PAGE): This technique preserves protein complexes in their native state, allowing visualization of intact ATP synthase complexes and sub-complexes. Digitonin (4:1 ratio) has been used successfully for solubilization before BN-PAGE analysis .

  • Yeast two-hybrid screening: Although challenging for membrane proteins, modified yeast two-hybrid systems can identify potential interaction partners.

  • Surface plasmon resonance (SPR): For validating and quantifying specific interaction candidates.

These methods have revealed that atpB interacts with regulatory proteins like CigR and MgtC in Salmonella, with these interactions playing important roles in virulence program regulation .

How does atpB contribute to Salmonella virulence mechanisms?

Recent research has uncovered intriguing connections between ATP synthase and bacterial virulence:

  • Interaction with virulence regulators: Studies have shown that Salmonella ATP synthase subunit β (AtpB) interacts with MgtC, a virulence protein that is critical during macrophage infection. The protein CigR acts as a checkpoint in this system, binding directly to MgtC and hindering its interaction with AtpB .

  • Energy modulation during infection: The interaction between virulence factors and ATP synthase components appears to regulate ATP levels during infection, which may help Salmonella adapt to the intracellular environment of host cells .

  • Temporal regulation: The virulence program involving ATP synthase interaction is temporally regulated, with MgtC expression levels determining whether it can overcome the CigR threshold to interact with AtpB .

Researchers investigating these interactions can employ:

  • Protein-protein interaction assays (Co-IP, pull-down assays)

  • ATP level measurements during infection

  • Growth assays under low Mg²⁺ conditions (which mimic aspects of the intracellular environment)

  • Gene expression analysis of virulence factors

How can atpB be utilized in recombinant vaccine development?

ATP synthase components have potential applications in vaccine development strategies:

  • Antigen delivery systems: Live attenuated Salmonella strains have been extensively explored as oral delivery systems for recombinant vaccine antigens. Incorporating atpB into these systems could enhance their efficacy .

  • Type I secretion systems: ATP-binding cassette (ABC) secretion systems appear particularly suited for recombinant extracellular expression in Salmonella. These systems could potentially be adapted to deliver atpB-based antigens .

  • Regulated delayed attenuation: Novel vaccine development technologies include regulated delayed in vivo attenuation and regulated delayed in vivo antigen synthesis. These approaches allow bacteria to efficiently colonize lymphoid tissues before displaying attenuation .

  • Lipid A modification: Modification of lipid A can reduce inflammatory responses without compromising vaccine efficiency, which could be relevant when using atpB as part of a vaccine construct .

Current limitations include low secretion capacity, complex genetic regulation, and structural restrictions, which researchers are working to overcome through development of more efficient recombinant protein secretion systems .

What role does atpB play in ATP synthase assembly and oligomerization?

The assembly and oligomerization of ATP synthase is a complex process in which atpB plays critical roles:

  • Assembly sequence: Research suggests that ATP synthase assembly in bacteria involves separate pathways that converge at the final stage. AtpB (subunit a) is typically added late in the assembly process .

  • Module formation: ATP synthase appears to form from three different modules: the c-ring, F1, and the a/A6L complex. AtpB is part of the a/A6L module that joins the partially assembled complex .

  • Oligomerization contribution: AtpB plays a crucial role in the formation of ATP synthase dimers and higher oligomers, which are important for proper enzyme function and potentially for shaping the membrane .

  • Stability role: Without atpB and A6L, ATP synthase forms a smaller 550 kDa complex instead of the complete 597 kDa holocomplex, indicating their essential role in complex stability .

Researchers can study these aspects using:

  • Clear native PAGE (CN-PAGE) with mild detergents like digitonin

  • Blue native PAGE (BN-PAGE) for complex analysis

  • In vitro reconstitution of ATP synthase components

  • Mutagenesis studies targeting specific atpB regions

How can researchers validate the structural integrity of recombinant atpB?

Validating the structural integrity of recombinant atpB is essential to ensure that experimental results reflect the protein's native properties:

  • Circular dichroism (CD) spectroscopy: CD can provide information about the secondary structure content and confirm proper folding of recombinant atpB.

  • Limited proteolysis: Properly folded atpB will display characteristic proteolytic patterns when subjected to limited digestion with proteases.

  • Fluorescence spectroscopy: Intrinsic fluorescence from tryptophan residues can provide information about the tertiary structure and environment of these residues within the protein.

  • Cryo-electron microscopy: When incorporated into the ATP synthase complex, properly folded atpB should participate in the expected structural arrangement visible under cryo-EM.

  • Functional assays: As previously described, proton translocation assays provide the ultimate validation that recombinant atpB maintains its native function.

For membrane proteins like atpB, it's particularly important to assess whether the recombinant protein has properly incorporated into membranes or detergent micelles, which can be evaluated using techniques such as density gradient centrifugation.

What mass spectrometry approaches are most suitable for atpB characterization?

Mass spectrometry offers powerful tools for characterizing recombinant atpB:

  • Intact protein analysis: Electrospray ionization mass spectrometry (ESI-MS) can confirm the molecular weight of the intact protein and identify any post-translational modifications.

  • Peptide mapping: Digestion of atpB followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) allows confirmation of the protein sequence and identification of any modifications.

  • Hydrogen-deuterium exchange (HDX-MS): This technique can provide information about protein dynamics and solvent accessibility of different regions of atpB.

  • Cross-linking MS: Cross-linking followed by MS analysis can identify interaction interfaces between atpB and other ATP synthase components.

  • Native MS: For membrane proteins like atpB, native MS in the presence of detergent micelles or nanodiscs can provide information about oligomeric states and complex formation.

When working with membrane proteins like atpB, special considerations for sample preparation are necessary, including appropriate detergent selection and optimization of ionization parameters.

How does Salmonella enteritidis PT4 atpB compare to atpB from other bacterial species?

Comparative analysis of atpB across bacterial species reveals important evolutionary and functional insights:

  • Sequence conservation: Core functional regions of atpB show high conservation across bacterial species, reflecting their essential role in proton translocation. The transmembrane regions typically show the highest conservation.

  • Cross-reactivity of antibodies: Research has demonstrated that antibodies against ATP synthase components often show cross-reactivity across species. For example, anti-AtpB antibodies can detect ATP synthase in various bacterial F-type ATP synthases .

  • Functional conservation: While the core function of proton translocation is conserved, species-specific variations may reflect adaptations to different environmental niches and energy requirements.

Researchers can perform comparative analyses using:

  • Multiple sequence alignments

  • Phylogenetic analyses

  • Structural modeling based on homology

  • Cross-species functional complementation assays

What are the key differences between bacterial atpB and mitochondrial ATP6?

Despite sharing evolutionary origins, bacterial atpB and mitochondrial ATP6 (the equivalent subunit in mitochondrial ATP synthase) exhibit several important differences:

  • Genetic encoding: Bacterial atpB is chromosomally encoded, while mitochondrial ATP6 is encoded by the mitochondrial genome in eukaryotes.

  • Size and structure: There are variations in size and specific structural features between bacterial and mitochondrial versions, though the core transmembrane regions are generally conserved.

  • Regulatory mechanisms: The regulation of expression and assembly differs substantially between bacterial atpB and mitochondrial ATP6, reflecting the different cellular contexts.

  • Inhibitor sensitivity: Sensitivity to specific inhibitors can differ between bacterial and mitochondrial ATP synthases, which has implications for antibacterial drug development.

  • Interaction partners: While both interact with their respective c-rings and peripheral stalks, the specific protein-protein interactions may vary between bacterial and mitochondrial systems.

Understanding these differences is crucial for researchers developing targeted antibacterial agents or studying the evolution of bioenergetic systems.

What are common issues in recombinant atpB expression and how can they be resolved?

Researchers frequently encounter several challenges when working with recombinant atpB:

ChallengePotential CausesSolutions
Low expression yieldToxicity to host cells, protein instability, inefficient translationUse tightly regulated expression systems; optimize codon usage; reduce expression temperature; use specialized E. coli strains (C41/C43) for membrane proteins
Inclusion body formationOverexpression, improper folding, hydrophobic nature of membrane proteinReduce induction temperature (16-20°C); use milder induction; add solubilizing agents; consider fusion partners to enhance solubility
Protein degradationProtease activity, intrinsic instabilityAdd protease inhibitors; optimize buffer conditions; express in protease-deficient strains; minimize time at room temperature
Poor membrane integrationOverwhelming Sec or Tat translocation machineryReduce expression levels; optimize signal sequences; consider specialized expression strains
Aggregation during purificationDetergent incompatibility, removal from membrane environmentScreen multiple detergents; include stabilizers (glycerol, specific lipids); maintain low temperature during purification

For atpB specifically, expression as a fusion protein with tags that enhance solubility or facilitate membrane integration may improve results. Additionally, storing the purified protein in buffers containing 50% glycerol helps maintain stability .

How can researchers troubleshoot non-functional recombinant atpB?

When recombinant atpB fails to demonstrate expected functionality, systematic troubleshooting approaches can identify and resolve issues:

  • Structural integrity assessment:

    • Analyze protein by CD spectroscopy to confirm secondary structure

    • Perform limited proteolysis to verify proper folding

    • Assess membrane integration using flotation assays

  • Interaction verification:

    • Confirm ability to interact with other ATP synthase components using pull-down assays

    • Verify complex formation using native PAGE techniques

  • Reconstitution optimization:

    • Test different lipid compositions for proteoliposome reconstitution

    • Vary protein-to-lipid ratios to identify optimal conditions

    • Ensure proper orientation in membrane (inside-out vs. right-side-out)

  • Functional assay validation:

    • Confirm assay functionality using positive controls

    • Verify that all necessary components for activity are present

    • Test under various conditions (pH, ion concentrations)

  • Mutation analysis:

    • Consider introducing known functional mutations to validate experimental setup

    • Compare with wild-type protein to identify specific deficiencies

When troubleshooting recombinant atpB function, it's important to remember that this protein operates as part of a complex. Therefore, successful functional assays may require reconstitution with additional ATP synthase components.

What emerging technologies show promise for atpB research?

Several cutting-edge technologies are expanding the possibilities for atpB research:

  • Cryo-electron microscopy advances: Improved resolution in cryo-EM is enabling more detailed structural analysis of membrane proteins like atpB within the context of the complete ATP synthase complex.

  • Single-molecule techniques: Methods such as single-molecule FRET and high-speed AFM allow researchers to observe conformational changes and dynamics in individual ATP synthase complexes containing atpB.

  • Nanodiscs and lipid cubic phase crystallization: These technologies provide more native-like environments for membrane proteins during structural studies.

  • Gene editing with CRISPR-Cas9: Precise genome editing allows for creation of subtle mutations in atpB to study structure-function relationships in the native context.

  • Advanced computational modeling: Molecular dynamics simulations and quantum mechanical calculations are providing insights into proton translocation mechanisms involving atpB.

These technologies are helping researchers address fundamental questions about how atpB contributes to the proton-motive force and ATP synthesis mechanisms.

What are promising directions for therapeutic applications targeting atpB?

Research on bacterial ATP synthase components like atpB shows potential for several therapeutic applications:

  • Antimicrobial development: The essential nature and structural differences from human homologs make bacterial ATP synthase an attractive target for new antibiotics. Compounds that specifically inhibit bacterial atpB could disrupt energy production in pathogens.

  • Vaccine strategies: As discussed previously, recombinant attenuated Salmonella vaccines (RASVs) show promise for antigen delivery. ATP synthase components might serve as antigens or delivery vehicles in these systems .

  • Immunomodulatory applications: The immunological profile of bacterial ATP synthase components might be exploited for immune response modulation.

  • Diagnostic markers: The presence of ectopic ATP synthase components has been identified in certain cancers, suggesting potential diagnostic applications .

Researchers continuing to explore these avenues should focus on:

  • Structural differences between bacterial and human ATP synthase components

  • Optimization of delivery systems for recombinant antigens

  • Development of high-throughput screening methods for atpB inhibitors

  • Further characterization of atpB's role in bacterial virulence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.