Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant CobS from Salmonella enteritidis PT4 is a 247-amino acid protein (UniProt ID: B5QYX4) encoded by the cobS gene. Key features include:

  • Expression System: Produced in E. coli with a His tag for purification .

  • Structural Domains: Predicted transmembrane regions consistent with its role as a membrane-associated enzyme .

  • Genomic Context: Located outside Salmonella Pathogenicity Islands (SPIs) but co-occurs with virulence genes linked to iron uptake and intestinal colonization .

Role in Cobalamin Biosynthesis

CobS catalyzes the penultimate step of adenosylcobalamin synthesis:

AdoCbi-GDP+α-ribazole phosphateCobSAdoCbl-P+GDP\text{AdoCbi-GDP} + \alpha\text{-ribazole phosphate} \xrightarrow{\text{CobS}} \text{AdoCbl-P} + \text{GDP}
  • Function: Condenses activated corrinoid (AdoCbi-GDP) and α-ribazole phosphate to form adenosylcobalamin 5′-phosphate (AdoCbl-P) .

  • Membrane Dependency: Activity increases 2.5-fold when reconstituted in liposomes, highlighting its reliance on a lipid bilayer for optimal function .

Table 1: Key Enzymatic Properties of CobS

PropertyValue/ObservationSource
SubstratesAdoCbi-GDP, α-ribazole-P
KmK_m (AdoCbi-GDP)0.8 μM (in liposomes)
Optimal pH7.5–8.0
Metal CofactorMg²⁺

Genomic and Pathogenicity Insights

  • Virulence Link: While cobS itself is not a direct virulence factor, cobalamin is essential for metabolizing 1,2-propanediol, a carbon source critical for gut colonization in some Salmonella serotypes .

  • Genetic Redundancy: Deletion of cobS in S. enteritidis PT4 did not impair intestinal colonization or systemic infection in chickens, suggesting functional redundancy or host-specific metabolic adaptations .

  • Conservation: The cobS gene is conserved across Salmonella serotypes but exhibits strain-specific regulatory elements .

Research Applications

  • Biochemical Studies: Recombinant CobS enables in vitro analysis of cobalamin biosynthesis, particularly membrane-associated enzymatic mechanisms .

  • Therapeutic Targeting: Inhibiting CobS could disrupt B₁₂-dependent pathways in Salmonella, though its non-essential role in certain hosts complicates this approach .

Comparative Genomic Analysis

Table 2: Genomic Features of S. enteritidis PT4 CobS vs. Other Serotypes

FeatureS. enteritidis PT4S. Typhimurium LT2
Gene LocationChromosomalChromosomal
SPI AssociationNot SPI-associatedNot SPI-associated
Prophage ElementsAbsentPresent in ϕSE20 prophage
CRISPR Loci2 systems1 system

Future Directions

  • Structural Studies: High-resolution crystallography to elucidate substrate-binding mechanisms.

  • In Vivo Role: Further exploration of CobS in non-avian hosts to assess metabolic indispensability.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; SEN2015; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella enteritidis PT4 (strain P125109)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Salmonella enteritidis* PT4 catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: set:SEN2015

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its functional role in Salmonella enteritidis PT4?

Cobalamin synthase (cobS) is an essential enzyme in the vitamin B12 (cobalamin) biosynthetic pathway of Salmonella enteritidis PT4. The enzyme functions as adenosylcobinamide-GDP ribazoletransferase (EC 2.-.-.-), catalyzing one of the final steps in cobalamin biosynthesis. In S. enteritidis PT4, cobS (gene locus SEN2015) encodes a 247-amino acid protein that plays a crucial role in the organism's metabolic processes .

The functional significance of cobS extends beyond basic metabolism. Studies of S. enteritidis PT4 genome reveal that metabolic genes, including those involved in vitamin biosynthesis pathways, can contribute to the organism's adaptability to different host environments. The genome of S. enteritidis PT4 strain 578 contains 4,506 coding sequences (CDS), with approximately 3.66% of these encoding virulence factors associated with cell invasion, intestinal colonization, and intracellular survival . While cobS itself is not directly classified as a virulence factor, metabolic adaptability mediated by enzymes like cobS can influence bacterial fitness during infection.

What are the recommended methods for expressing and purifying recombinant cobS from Salmonella enteritidis PT4?

Based on established protocols in the literature, the following methodological approach is recommended for expression and purification of recombinant cobS:

Expression System:

  • Host: E. coli is the preferred expression system, as demonstrated by successful production of recombinant full-length S. enteritidis PT4 cobS protein

  • Vector: pET-based expression vectors with N-terminal His-tag fusion

  • Induction: IPTG induction at mid-log phase (OD600 ~0.6-0.8)

Purification Protocol:

  • Harvest cells by centrifugation (6,000 × g, 15 minutes, 4°C)

  • Resuspend in lysis buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors

  • Lyse cells by sonication or pressure-based cell disruption

  • Clarify lysate by centrifugation (15,000 × g, 30 minutes, 4°C)

  • Purify using Ni-NTA affinity chromatography

  • Wash with buffer containing 20-50 mM imidazole

  • Elute with buffer containing 250-300 mM imidazole

  • Perform buffer exchange to Tris-based buffer with 50% glycerol for storage

The purified protein should be stored at -20°C/-80°C, and repeated freeze-thaw cycles should be avoided. For extended use, working aliquots can be stored at 4°C for up to one week .

How does the expression of cobS change during host colonization by S. enteritidis PT4?

Transcriptional analysis of S. enteritidis PT4 during intestinal colonization reveals significant changes in metabolic gene expression, including genes involved in vitamin biosynthesis pathways. Studies using microarray analysis to examine gene expression patterns during colonization of chicken caeca demonstrated that 34% of genes showed significant changes in expression levels compared to in vitro growth conditions .

While specific data on cobS expression was not directly provided in the search results, research on S. enteritidis PT4 colonization in 1-day chickens showed that:

  • Major changes occurred in genes related to adaptation to the caecal environment

  • Up-regulation was observed in genes required for energy generation and carbohydrate metabolism/transport

  • Down-regulation occurred in genes involved in amino acid metabolism, nucleotide metabolism, translation, replication, and cell wall biogenesis

The TCA cycle-associated genes were significantly up-regulated (>2 fold) during colonization, suggesting metabolic adaptation to the intestinal environment . The regulatory patterns suggest that cobS expression may be modulated as part of the metabolic reprogramming that occurs during host colonization, particularly in relation to nutrient acquisition strategies in the intestinal environment.

What methodological approaches can be used to study the role of cobS in virulence and pathogenicity of S. enteritidis PT4?

To investigate the role of cobS in virulence and pathogenicity, researchers can employ the following methodological approaches:

1. Gene Deletion Mutagenesis:

  • Use lambda Red recombination system (Datsenko-Wanner method) to create precise gene deletions

  • Generate a Δcobs mutant by replacing the cobS gene with an antibiotic resistance cassette

  • Validate mutation using PCR with primers specific to flanking regions and the antibiotic cassette

2. Complementation Studies:

  • Reintroduce the wild-type cobS gene on a plasmid into the Δcobs mutant

  • Express under native or inducible promoters to confirm phenotype rescue

3. In Vitro Virulence Assays:

  • Cell invasion assays using epithelial cell lines (e.g., Caco-2, HT-29)

  • Measure invasion and intracellular survival using gentamicin protection assays

  • Assess phagocytosis and survival within macrophages (e.g., HD11 chicken macrophage cells)

4. In Vivo Colonization Models:

  • Use one-day-old chick models for intestinal colonization studies

  • Intratracheal or oral gavage administration of wild-type and Δcobs mutants

  • Quantify bacterial loads in cecal contents and tissues

  • Compare colonization efficiency between wild-type and mutant strains

5. Transcriptional Analysis:

  • Perform RNA-seq or microarray analysis to compare gene expression profiles

  • Identify genes differentially regulated in response to cobS deletion

  • Cross-reference with known virulence pathways

6. Metabolomic Analysis:

  • Use LC-MS/MS to profile metabolic changes in Δcobs mutants

  • Specifically examine vitamin B12-dependent metabolic pathways

  • Correlate metabolic alterations with virulence phenotypes

This multi-faceted approach would provide comprehensive insights into the contribution of cobS to S. enteritidis PT4 pathogenicity.

What are the key differences in cobS sequence and function between S. enteritidis PT4 and other Salmonella serotypes?

Comparative genomic analysis reveals both conservation and variation in cobS across Salmonella serotypes:

Comparative Analysis:
When comparing S. enteritidis PT4 with other serotypes such as S. Typhimurium:

  • Whole genome sequence analysis shows that most unshared genes between S. enteritidis PT4 and S. Typhimurium are related to metabolism, membrane proteins, and hypothetical proteins

  • Comparative genome analysis between S. enteritidis PT4 strain 578 and reference strains (S. enteritidis ATCC 13076, S. Typhimurium ATCC 13311, and S. Typhimurium ATCC 14028) demonstrated that metabolic genes, including those in biosynthetic pathways, contribute to serotype-specific adaptations

  • Phenotypic differences between S. enteritidis PT4 and other serotypes regarding the expression of red, dry, and rough (rdar) morphotype and biofilm formation suggest metabolic adaptations that may involve vitamin B12-dependent pathways

These comparative studies suggest that while cobS maintains its core enzymatic function across serotypes, subtle variations may contribute to metabolic fine-tuning that influences host adaptation and pathogenicity.

What experimental approaches can be used to study the conformational changes in cobalamin-dependent enzymes related to cobS function?

Understanding conformational changes in cobalamin-dependent enzymes provides insight into cobS function. Based on research on related cobalamin-dependent enzymes, the following experimental approaches are recommended:

1. Small-Angle X-ray Scattering (SAXS):

  • SAXS can yield direct structural information on solution conformational ensembles

  • Particularly effective for detecting subtle conformational changes in flexible, multidomain proteins

  • Can be used to compare different states of the enzyme (e.g., oxidized vs. reduced states)

2. Cryo-Electron Microscopy (Cryo-EM):

  • High-resolution structural analysis of protein complexes in various conformational states

  • Can be combined with structure prediction to provide a comprehensive view of enzyme dynamics

3. UV-Vis Absorption Spectroscopy:

  • Monitor interconversion of His-on and His-off states of cobalamin cofactors

  • Detect substrate-induced conformational changes

  • Assess cofactor oxidation states (e.g., Cob(I), Cob(II), CH3-Cob(III))

4. CASSCF Geometry Optimization:

  • Computational approach to model molecular orbital changes during catalysis

  • Can predict bond distances and conformational changes during enzyme function

  • Particularly useful for studying the Co-N axial bond distances in cobalamin

5. Differential Scanning Calorimetry (DSC):

  • Measure thermal stability changes associated with different conformational states

  • Detect substrate or cofactor binding effects on protein stability

6. Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Map regions of conformational flexibility and solvent accessibility

  • Identify dynamic regions involved in catalysis or regulation

These methodologies, when applied to cobS and related enzymes, can provide valuable insights into the conformational dynamics essential for cobalamin synthesis in S. enteritidis PT4.

How can research on cobS inform the development of novel antimicrobial strategies against S. enteritidis PT4?

Research on cobS can inform antimicrobial development through several strategic approaches:

1. Metabolic Vulnerability Targeting:

  • Cobalamin biosynthesis represents a metabolic vulnerability in Salmonella

  • Inhibitors designed against cobS could disrupt vitamin B12 production, affecting multiple downstream metabolic pathways

  • Metabolic modeling can identify synergistic targets in related pathways

2. Vaccine Development Strategies:

  • Live attenuated vaccines based on metabolic gene deletions have shown promise

  • While not directly demonstrated for cobS, similar approaches with other metabolic genes have been effective

  • For example, guaB deletion mutants of S. enteritidis PT4 showed reduced virulence while maintaining immunogenicity

3. Structure-Based Drug Design:

  • The amino acid sequence and structural information of cobS can inform rational drug design

  • Virtual screening against the cobS active site could identify potential inhibitors

  • Fragment-based approaches targeting catalytic residues could yield selective inhibitors

4. Combination Therapy Approaches:

  • Combining cobS inhibitors with conventional antibiotics may enhance efficacy

  • Target synergistic pathways to reduce resistance development

  • Metabolic inhibitors may sensitize bacteria to other antimicrobials

5. Host-Pathogen Interface Targeting:

  • Understanding how cobS contributes to adaptation during host colonization

  • Target metabolic adaptations that occur during infection

  • Develop compounds that interfere with metabolic reprogramming during infection

Research indicates that S. enteritidis PT4 undergoes significant metabolic adaptation during host colonization, with 34% of genes showing altered expression . Targeting these adaptation mechanisms, including those involving cobS, could provide novel antimicrobial strategies against this important foodborne pathogen.

What technical challenges are associated with producing active recombinant cobS protein for enzymatic studies?

Producing active recombinant cobS presents several technical challenges that researchers should address:

1. Protein Solubility and Folding:

  • As a membrane-associated protein, cobS can exhibit poor solubility in aqueous buffers

  • Optimization strategies include:

    • Using solubility-enhancing fusion tags (e.g., SUMO, MBP) in addition to His-tag

    • Expressing at lower temperatures (16-18°C) to improve folding

    • Including detergents or lipid mimetics in purification buffers

2. Cofactor Requirements:

  • Cobalamin-associated enzymes often require specific cofactors for activity

  • Supplementation with appropriate cofactors during expression or purification may be necessary

  • Reconstitution protocols may be required to obtain fully active enzyme

3. Oxidation Sensitivity:

  • Cobalamin enzymes are sensitive to oxidation state changes

  • Maintaining appropriate reducing conditions during purification

  • Including reducing agents (e.g., DTT, 2-mercaptoethanol) in buffers

  • Handling under anaerobic conditions when necessary

4. Activity Assays:

  • Developing reliable activity assays for cobS function

  • Adenosylcobinamide-GDP ribazoletransferase activity measurement requires specialized substrates

  • Coupling assays to more easily detectable reactions may be necessary

5. Storage Stability:

  • Current protocols recommend storage in Tris-based buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles

  • Maintain working aliquots at 4°C for up to one week

  • For long-term storage, store at -20°C/-80°C in small aliquots

6. Expression Host Considerations:

  • While E. coli is the standard expression host, endogenous cobalamin pathways may interfere

  • Consider using E. coli strains with deletions in relevant pathways

  • Alternative expression hosts may be considered for specific applications

Addressing these challenges requires careful optimization of expression and purification protocols, with particular attention to maintaining the native conformation and enzymatic activity of cobS.

How can researchers distinguish between conformational changes in cobS that are physiologically relevant versus artifacts of experimental conditions?

Distinguishing between physiologically relevant conformational changes and experimental artifacts requires rigorous methodological approaches:

1. Multi-technique Validation:

  • Employ multiple complementary structural techniques (SAXS, cryo-EM, spectroscopy)

  • Compare results across different methodologies to identify consistent conformational features

  • Inconsistencies between techniques may indicate artifacts

2. Solution Condition Controls:

  • Systematically vary buffer conditions (pH, ionic strength, temperature)

  • Compare conformational states across physiologically relevant conditions

  • Establish baseline conformational distributions under standard conditions

3. Substrate and Cofactor Effects:

  • Examine conformational changes in the presence of natural substrates and products

  • Test concentration-dependent effects to establish physiological relevance

  • For cobalamin-dependent enzymes, the interconversion of His-on and His-off states can be modulated by substrates and products

4. Mutation Studies:

  • Create point mutations in key residues predicted to affect conformational changes

  • Analyze how these mutations alter the conformational landscape

  • Compare with known functional consequences of these mutations

5. Correlate with Enzymatic Activity:

  • Establish relationships between observed conformational states and enzymatic activity

  • Functional assays should be performed under the same conditions as structural studies

  • Temporal correlation between conformational changes and catalytic events strengthens physiological relevance

6. Computational Validation:

  • Use molecular dynamics simulations to predict conformational changes

  • Compare computational predictions with experimental observations

  • Energy landscape analysis can help distinguish between stable conformations and transient artifacts

Research on cobalamin-dependent enzymes has shown that conformational switching is essential for function, with the cobalamin cofactor moving between different active sites during catalysis . Applying these approaches to cobS would help establish which conformational changes are integral to its enzymatic function.

What are the latest methodological advances in studying the interaction between cobS and other components of the cobalamin biosynthetic pathway?

Recent methodological advances offer new approaches to understanding cobS interactions within the cobalamin biosynthetic pathway:

1. Proximity-Based Protein Interaction Mapping:

  • BioID or APEX2 proximity labeling to identify proteins that interact with cobS in vivo

  • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • These methods can reveal interaction partners not detected by traditional approaches

2. Cryo-Electron Tomography:

  • Visualize macromolecular complexes in their native cellular environment

  • Map the spatial organization of cobalamin biosynthetic enzymes in bacterial cells

  • Identify membrane associations and subcellular localization

3. Native Mass Spectrometry:

  • Analyze intact protein complexes under near-native conditions

  • Determine stoichiometry and composition of multi-protein assemblies

  • Study cofactor binding and complex formation dynamics

4. Single-Molecule Techniques:

  • Single-molecule FRET to monitor conformational dynamics in real-time

  • Optical tweezers or atomic force microscopy to measure forces involved in conformational changes

  • These approaches can detect heterogeneity not apparent in ensemble measurements

5. Integrative Structural Biology:

  • Combine multiple data sources (SAXS, cryo-EM, X-ray crystallography)

  • Computational integration to generate comprehensive structural models

  • Particularly powerful for flexible, multi-domain enzymes like those in the cobalamin pathway

6. In-Cell NMR Spectroscopy:

  • Monitor protein-protein interactions and conformational changes within living cells

  • Provide physiologically relevant information about cobS function

  • Can be combined with selective isotope labeling for specific visualization

7. Metabolic Flux Analysis:

  • Track the flow of metabolites through the cobalamin biosynthetic pathway

  • Identify rate-limiting steps and regulatory points

  • Combine with genetic manipulation of cobS to assess pathway impacts

These advanced methodologies can provide unprecedented insights into how cobS functions within the broader context of cobalamin biosynthesis in S. enteritidis PT4, potentially revealing new targets for antimicrobial intervention.

How should researchers interpret discrepancies between computational models and experimental data for cobS function?

When faced with discrepancies between computational predictions and experimental results for cobS function, researchers should apply the following analytical framework:

1. Systematic Validation Process:

  • Reassess the validity of computational model parameters

  • Verify experimental protocols for potential procedural artifacts

  • Determine if discrepancies are qualitative or quantitative in nature

2. Evaluate Model Limitations:

  • Consider whether the computational model includes all relevant factors:

    • Does it account for protein dynamics and flexibility?

    • Are cofactors and substrates accurately represented?

    • Are protein-solvent interactions adequately modeled?

  • Research on cobalamin-dependent enzymes has shown that DFT-based methods may yield results contradicting experimental data due to incomplete modeling of electronic interactions

3. Examine Experimental Conditions:

  • Assess whether experimental conditions match physiological relevance:

    • pH and ionic strength effects

    • Presence of necessary cofactors

    • Protein concentration effects (aggregation at high concentrations)

  • For instance, the His-on/off equilibrium in cobalamin is pH-dependent and affects enzyme conformation

4. Bridging the Gap:

  • Design targeted experiments to specifically address the discrepancy

  • Refine computational models based on experimental feedback

  • Consider developing hybrid approaches that combine experimental constraints with computational modeling

5. Case Study Example:

  • Research on cobalamin-dependent methionine synthase revealed that CASSCF geometry optimization predicted Co-N bond distance increases that were initially not supported by experimental data

  • Further investigation showed that the discrepancy was due to electron density transfer processes not fully captured in initial models

  • The refined computational approach ultimately aligned with experimental results

6. Data Integration Approach:

  • When persistent discrepancies exist, develop an integrative model that weights multiple data sources

  • Use Bayesian statistical frameworks to update model confidence based on new data

  • Present alternative interpretations when a single conclusive model cannot be established

By applying this systematic approach to resolving discrepancies, researchers can advance understanding of cobS function and the broader cobalamin biosynthetic pathway in S. enteritidis PT4.

What statistical methods are most appropriate for analyzing gene expression data related to cobS in different experimental conditions?

When analyzing gene expression data for cobS across various experimental conditions, researchers should consider these statistical approaches:

1. Differential Expression Analysis:

  • Linear models (limma) for microarray data

  • Negative binomial models (DESeq2, edgeR) for RNA-seq data

  • Include appropriate normalization methods to account for technical variation

  • When analyzing S. enteritidis PT4 gene expression during chicken colonization, researchers found 34% of genes showed significant changes compared to in vitro conditions

2. Multiple Testing Correction:

  • Apply Benjamini-Hochberg procedure to control false discovery rate (FDR)

  • For focused studies on metabolic pathways including cobS, consider:

    • Setting FDR threshold at q < 0.05 for broad screening

    • Using more stringent thresholds (q < 0.01) for follow-up validation

  • Report both p-values and adjusted p-values in publications

3. Effect Size Estimation:

  • Report fold changes with confidence intervals

  • Use log2 transformation for symmetrical representation of up/down-regulation

  • Consider biological significance thresholds (e.g., >2-fold change)

  • In S. enteritidis PT4 studies, TCA cycle genes showed >2-fold upregulation during colonization

4. Time-Series Analysis:

  • For studies tracking cobS expression over time:

    • Apply functional data analysis (FDA)

    • Use autoregressive models to account for temporal correlation

    • Consider mixed-effect models for repeated measures designs

5. Multivariate Methods:

6. Integration with Functional Annotation:

  • Gene Set Enrichment Analysis (GSEA) to identify coordinated changes in pathways

  • Over-representation analysis (ORA) to identify enriched functional categories

  • Cluster of Orthologous Groups (COGs) classification to compare metabolic functions

7. Validation Methods:

  • Quantitative RT-PCR for validation of key findings

  • Report correlation between microarray/RNA-seq and qPCR results

  • In S. enteritidis PT4 studies, microarray results showed 96% compatibility with RT-qPCR validation

How can researchers effectively integrate genomic, transcriptomic, and metabolomic data to understand the role of cobS in Salmonella pathogenicity?

Integrating multi-omics data provides a comprehensive understanding of cobS function in Salmonella pathogenicity. The following methodological framework is recommended:

1. Data Collection and Preprocessing:

  • Genomic data: Whole genome sequencing with adequate coverage (>30×)

  • Transcriptomic data: RNA-seq or microarray analysis under relevant conditions

  • Metabolomic data: Targeted and untargeted LC-MS/MS or NMR

  • Standardize data formats and apply quality control measures for each data type

2. Integrative Analysis Strategies:

  • Sequential integration: Use genomic information to interpret transcriptomic changes, then link to metabolic profiles

  • Pathway-based integration: Map all data types to common pathways (e.g., KEGG or BioCyc)

  • Network-based integration: Construct multi-layered networks connecting genes, transcripts, and metabolites

  • Statistical integration: Apply multi-block methods like DIABLO or MOFA

3. Specific Integration Points:

  • Map cobS genomic variations across Salmonella strains to phenotypic differences

  • Correlate cobS expression levels with metabolite abundances in cobalamin-dependent pathways

  • Identify transcription factors regulating cobS expression under infection-relevant conditions

4. Case Study Application:

  • Research on S. enteritidis PT4 demonstrated that integrating genomic analysis with phenotypic characterization revealed differences in virulence characteristics

  • Of 4,506 coding sequences in S. enteritidis PT4 strain 578, 3.66% encoded virulence factors associated with cell invasion, intestinal colonization, and intracellular survival

  • Transcriptional analysis showed that 34% of genes changed expression during chicken colonization

  • Integration of these data types could reveal how cobS fits within this adaptive response

5. Visualization and Interpretation:

  • Develop multi-layered visualizations showing relationships across data types

  • Apply dimensionality reduction techniques to identify patterns across datasets

  • Create interactive visualizations that allow exploration of different biological scales

6. Validation Approaches:

  • Gene deletion studies to confirm predicted functional relationships

  • Metabolic complementation experiments

  • In vivo infection models to validate pathogenicity predictions

7. Data Sharing and Reproducibility:

  • Deposit raw data in appropriate repositories (e.g., GEO, MetaboLights)

  • Provide detailed metadata and analysis workflows

  • Make integration scripts and pipelines publicly available

This integrative approach provides a systems-level understanding of how cobS contributes to S. enteritidis PT4 pathogenicity by connecting genomic features to transcriptional responses and metabolic adaptations during infection.

What are the most promising future research directions for understanding cobS function in Salmonella infection biology?

Future research into cobS function in Salmonella infection biology should focus on these high-potential directions:

1. Host-Microbiome-Pathogen Interactions:

  • Investigate how cobS-dependent metabolism influences competition with gut microbiota

  • Examine whether cobalamin biosynthesis provides competitive advantages during colonization

  • Study how host vitamin B12 levels affect S. enteritidis PT4 virulence strategies

2. Single-Cell Analysis of Metabolic Heterogeneity:

  • Apply single-cell RNA-seq to profile cobS expression in bacterial subpopulations during infection

  • Determine if metabolic specialization occurs within the infecting population

  • Link cobS expression patterns to persistence and antibiotic tolerance

3. Structural Biology of Cobalamin Biosynthesis Complexes:

  • Determine high-resolution structures of multi-enzyme complexes involved in cobalamin biosynthesis

  • Map interaction networks centering on cobS

  • Develop structure-based inhibitors targeting key protein-protein interactions

4. Systems Biology of Metabolic Adaptation:

  • Apply genome-scale metabolic models to predict adaptations under infection conditions

  • Identify metabolic vulnerabilities that emerge during host adaptation

  • Model metabolic flux changes in cobalamin-dependent pathways during infection

5. Evolutionary Dynamics of Cobalamin Pathways:

  • Compare cobS sequence and function across Salmonella lineages with different host ranges

  • Identify signatures of selection in cobS and related genes

  • Determine how metabolic capabilities correlate with evolutionary success in different niches

6. Novel Antimicrobial Strategies:

  • Develop cobS inhibitors as antivirulence compounds

  • Design metabolic adjuvants that sensitize bacteria to conventional antibiotics

  • Create vaccines based on attenuated strains with modified metabolic capabilities, building on successful approaches with other metabolic genes

7. Translational Research Applications:

  • Develop diagnostic tools based on metabolic signatures associated with cobS activity

  • Engineer probiotics to compete with Salmonella for cobalamin-dependent resources

  • Create nutritional interventions that exploit metabolic vulnerabilities

These research directions would significantly advance understanding of how cobS contributes to S. enteritidis PT4 pathobiology and could lead to novel strategies for prevention and treatment of Salmonella infections.

How might new structural biology techniques advance our understanding of cobS function and regulation?

Emerging structural biology techniques offer unprecedented opportunities to elucidate cobS function and regulation:

1. Cryo-Electron Microscopy (Cryo-EM) Advances:

  • Single-particle analysis: Determine high-resolution structures of cobS in different functional states

  • Time-resolved cryo-EM: Capture transient intermediates during catalytic cycles

  • Micro-electron diffraction (MicroED): Determine structures from microcrystals for challenging proteins

  • Research on cobalamin-dependent enzymes has already benefited from cryo-EM to characterize conformational states

2. Integrative Structural Biology Approaches:

  • Hybrid methods: Combine cryo-EM, SAXS, X-ray crystallography, and NMR data

  • Cross-linking mass spectrometry (XL-MS): Map protein-protein interaction interfaces

  • Computational integration: Develop comprehensive structural models incorporating data from multiple sources

  • These approaches are particularly valuable for dynamic enzymes like those in cobalamin pathways

3. In-Cell Structural Biology:

  • In-cell NMR: Observe protein structure and dynamics in the cellular environment

  • Cryo-electron tomography: Visualize macromolecular complexes in their native context

  • Correlative light and electron microscopy (CLEM): Connect functional and structural observations

4. Computational Structure Prediction:

  • AI-based methods (AlphaFold, RoseTTAFold): Predict structures with unprecedented accuracy

  • Molecular dynamics simulations: Model dynamic processes on physiologically relevant timescales

  • Quantum mechanics/molecular mechanics (QM/MM): Model catalytic mechanisms with electronic detail

  • CASSCF geometry optimization has provided insights into conformational changes in cobalamin enzymes

5. Dynamic Structural Analysis:

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS): Map protein dynamics and conformational changes

  • Single-molecule FRET: Track conformational changes in real-time

  • Time-resolved serial crystallography: Capture intermediates during catalysis

6. Specific Applications to cobS:

  • Determine how cobS interacts with other enzymes in the cobalamin biosynthetic pathway

  • Characterize conformational changes associated with substrate binding and product release

  • Identify allosteric regulatory sites that could be targeted for antimicrobial development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.